summaryrefslogtreecommitdiff
path: root/doc/api
diff options
context:
space:
mode:
authorGitLab Bot <gitlab-bot@gitlab.com>2021-08-19 09:08:42 +0000
committerGitLab Bot <gitlab-bot@gitlab.com>2021-08-19 09:08:42 +0000
commitb76ae638462ab0f673e5915986070518dd3f9ad3 (patch)
treebdab0533383b52873be0ec0eb4d3c66598ff8b91 /doc/api
parent434373eabe7b4be9593d18a585fb763f1e5f1a6f (diff)
downloadgitlab-ce-14.2.0-rc42.tar.gz
Add latest changes from gitlab-org/gitlab@14-2-stable-eev14.2.0-rc42
Diffstat (limited to 'doc/api')
-rw-r--r--doc/api/README.md1
-rw-r--r--doc/api/api_resources.md4
-rw-r--r--doc/api/audit_events.md12
-rw-r--r--doc/api/bulk_imports.md41
-rw-r--r--doc/api/container_registry.md49
-rw-r--r--doc/api/custom_attributes.md4
-rw-r--r--doc/api/dependencies.md2
-rw-r--r--doc/api/discussions.md12
-rw-r--r--doc/api/dora4_group_analytics.md9
-rw-r--r--doc/api/environments.md46
-rw-r--r--doc/api/error_tracking.md15
-rw-r--r--doc/api/events.md6
-rw-r--r--doc/api/experiments.md50
-rw-r--r--doc/api/features.md2
-rw-r--r--doc/api/freeze_periods.md2
-rw-r--r--doc/api/graphql/audit_report.md4
-rw-r--r--doc/api/graphql/custom_emoji.md2
-rw-r--r--doc/api/graphql/getting_started.md4
-rw-r--r--doc/api/graphql/img/custom_emoji_query_example.pngbin178815 -> 51531 bytes
-rw-r--r--doc/api/graphql/index.md4
-rw-r--r--doc/api/graphql/reference/index.md1145
-rw-r--r--doc/api/graphql/removed_items.md4
-rw-r--r--doc/api/graphql/users_example.md4
-rw-r--r--doc/api/group_milestones.md8
-rw-r--r--doc/api/group_protected_environments.md2
-rw-r--r--doc/api/group_repository_storage_moves.md44
-rw-r--r--doc/api/groups.md11
-rw-r--r--doc/api/index.md23
-rw-r--r--doc/api/invitations.md1
-rw-r--r--doc/api/issues.md1
-rw-r--r--doc/api/job_artifacts.md4
-rw-r--r--doc/api/members.md12
-rw-r--r--doc/api/merge_request_approvals.md2
-rw-r--r--doc/api/merge_requests.md1
-rw-r--r--doc/api/namespaces.md52
-rw-r--r--doc/api/oauth2.md46
-rw-r--r--doc/api/openapi/openapi_interactive.md4
-rw-r--r--doc/api/packages/debian.md128
-rw-r--r--doc/api/packages/debian_group_distributions.md33
-rw-r--r--doc/api/packages/debian_project_distributions.md32
-rw-r--r--doc/api/packages/helm.md3
-rw-r--r--doc/api/pipelines.md61
-rw-r--r--doc/api/project_badges.md1
-rw-r--r--doc/api/project_repository_storage_moves.md2
-rw-r--r--doc/api/projects.md79
-rw-r--r--doc/api/releases/index.md9
-rw-r--r--doc/api/repositories.md20
-rw-r--r--doc/api/repository_files.md2
-rw-r--r--doc/api/services.md25
-rw-r--r--doc/api/settings.md15
-rw-r--r--doc/api/snippet_repository_storage_moves.md2
-rw-r--r--doc/api/system_hooks.md4
-rw-r--r--doc/api/usage_data.md2
-rw-r--r--doc/api/users.md33
-rw-r--r--doc/api/v3_to_v4.md4
-rw-r--r--doc/api/version.md4
56 files changed, 1536 insertions, 556 deletions
diff --git a/doc/api/README.md b/doc/api/README.md
index 5ab8653dc35..0e6c2f63f9e 100644
--- a/doc/api/README.md
+++ b/doc/api/README.md
@@ -1,5 +1,6 @@
---
redirect_to: 'index.md'
+remove_date: '2021-09-28'
---
This document was moved to [another location](index.md).
diff --git a/doc/api/api_resources.md b/doc/api/api_resources.md
index 6c9baab83e9..aae76697841 100644
--- a/doc/api/api_resources.md
+++ b/doc/api/api_resources.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/audit_events.md b/doc/api/audit_events.md
index 8fbee89f9be..3ffcae04791 100644
--- a/doc/api/audit_events.md
+++ b/doc/api/audit_events.md
@@ -23,8 +23,8 @@ GET /audit_events
| Attribute | Type | Required | Description |
| --------- | ---- | -------- | ----------- |
-| `created_after` | string | no | Return audit events created on or after the given time. Format: ISO 8601 YYYY-MM-DDTHH:MM:SSZ |
-| `created_before` | string | no | Return audit events created on or before the given time. Format: ISO 8601 YYYY-MM-DDTHH:MM:SSZ |
+| `created_after` | string | no | Return audit events created on or after the given time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ`) |
+| `created_before` | string | no | Return audit events created on or before the given time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ`) |
| `entity_type` | string | no | Return audit events for the given entity type. Valid values are: `User`, `Group`, or `Project`. |
| `entity_id` | integer | no | Return audit events for the given entity ID. Requires `entity_type` attribute to be present. |
@@ -148,8 +148,8 @@ GET /groups/:id/audit_events
| Attribute | Type | Required | Description |
| --------- | ---- | -------- | ----------- |
| `id` | integer/string | yes | The ID or [URL-encoded path of the group](index.md#namespaced-path-encoding) |
-| `created_after` | string | no | Return group audit events created on or after the given time. Format: ISO 8601 YYYY-MM-DDTHH:MM:SSZ |
-| `created_before` | string | no | Return group audit events created on or before the given time. Format: ISO 8601 YYYY-MM-DDTHH:MM:SSZ |
+| `created_after` | string | no | Return group audit events created on or after the given time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ)` |
+| `created_before` | string | no | Return group audit events created on or before the given time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ`) |
By default, `GET` requests return 20 results at a time because the API results
are paginated.
@@ -255,8 +255,8 @@ GET /projects/:id/audit_events
| Attribute | Type | Required | Description |
| --------- | ---- | -------- | ----------- |
| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) |
-| `created_after` | string | no | Return project audit events created on or after the given time. Format: ISO 8601 YYYY-MM-DDTHH:MM:SSZ |
-| `created_before` | string | no | Return project audit events created on or before the given time. Format: ISO 8601 YYYY-MM-DDTHH:MM:SSZ |
+| `created_after` | string | no | Return project audit events created on or after the given time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ`) |
+| `created_before` | string | no | Return project audit events created on or before the given time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ`) |
By default, `GET` requests return 20 results at a time because the API results
are paginated.
diff --git a/doc/api/bulk_imports.md b/doc/api/bulk_imports.md
index 9521c769d49..2325f25e789 100644
--- a/doc/api/bulk_imports.md
+++ b/doc/api/bulk_imports.md
@@ -11,6 +11,47 @@ info: To determine the technical writer assigned to the Stage/Group associated w
With the GitLab Migrations API, you can view the progress of migrations initiated with
[GitLab Group Migration](../user/group/import/index.md).
+## Start a new GitLab migration
+
+> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/66353) in GitLab 14.2.
+
+```plaintext
+POST /bulk_imports
+```
+
+| Attribute | Type | Required | Description |
+| --------------------------------- | ------ | -------- | ----------- |
+| `configuration` | Hash | yes | The source GitLab instance configuration. |
+| `configuration[url]` | String | yes | Source GitLab instance URL. |
+| `configuration[access_token]` | String | yes | Access token to the source GitLab instance. |
+| `entities` | Array | yes | List of entities to import. |
+| `entities[source_type]` | String | yes | Source entity type (only `group_entity` is supported). |
+| `entities[source_full_path]` | String | yes | Source full path of the entity to import. |
+| `entities[destination_name]` | String | yes | Destination name for the entity. |
+| `entities[destination_namespace]` | String | no | Destination namespace for the entity. |
+
+```shell
+curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/bulk_imports" \
+ --data '{
+ "configuration": {
+ "url": "http://gitlab.example/",
+ "access_token": "access_token"
+ },
+ "entities": [
+ {
+ "source_full_path": "source/full/path",
+ "source_type": "group_entity",
+ "destination_name": "destination_name",
+ "destination_namespace": "destination/namespace/path"
+ }
+ ]
+ }'
+```
+
+```json
+{ "id": 1, "status": "created", "source_type": "gitlab", "created_at": "2021-06-18T09:45:55.358Z", "updated_at": "2021-06-18T09:46:27.003Z" }
+```
+
## List all GitLab migrations
```plaintext
diff --git a/doc/api/container_registry.md b/doc/api/container_registry.md
index cf5a7f89c8b..12bdeebca1d 100644
--- a/doc/api/container_registry.md
+++ b/doc/api/container_registry.md
@@ -30,6 +30,55 @@ To disable it:
Feature.disable(:ci_job_token_scope)
```
+## Change the visibility of the Container Registry
+
+This controls who can view the Container Registry.
+
+```plaintext
+PUT /projects/:id/
+```
+
+| Attribute | Type | Required | Description |
+| --------- | ---- | -------- | ----------- |
+| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) accessible by the authenticated user. |
+| `container_registry_access_level` | string | no | The desired visibility of the Container Registry. One of `enabled` (default), `private`, or `disabled`. |
+
+Descriptions of the possible values for `container_registry_access_level`:
+
+- **enabled** (Default): The Container Registry is visible to everyone with access to the project.
+If the project is public, the Container Registry is also public. If the project is internal or
+private, the Container Registry is also internal or private.
+
+- **private**: The Container Registry is visible only to project members with Reporter role or
+higher. This is similar to the behavior of a private project with Container Registry visibility set
+to **enabled**.
+
+- **disabled**: The Container Registry is disabled.
+
+See the [Container Registry visibility permissions](../user/packages/container_registry/index.md#container-registry-visibility-permissions)
+for more details about the permissions that this setting grants to users.
+
+```shell
+curl --request PUT "https://gitlab.example.com/api/v4/projects/5/" \
+ --header 'PRIVATE-TOKEN: <your_access_token>' \
+ --header 'Accept: application/json' \
+ --header 'Content-Type: application/json' \
+ --data-raw '{
+ "container_registry_access_level": "private"
+ }'
+```
+
+Example response:
+
+```json
+{
+ "id": 5,
+ "name": "Project 5",
+ "container_registry_access_level": "private",
+ ...
+}
+```
+
## List registry repositories
### Within a project
diff --git a/doc/api/custom_attributes.md b/doc/api/custom_attributes.md
index 56a9f6881cd..9908c58de35 100644
--- a/doc/api/custom_attributes.md
+++ b/doc/api/custom_attributes.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/dependencies.md b/doc/api/dependencies.md
index c85a3521aed..c8b928ab5b2 100644
--- a/doc/api/dependencies.md
+++ b/doc/api/dependencies.md
@@ -31,7 +31,7 @@ GET /projects/:id/dependencies?package_manager=yarn,bundler
| Attribute | Type | Required | Description |
| ------------- | -------------- | -------- | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding). |
-| `package_manager` | string array | no | Returns dependencies belonging to specified package manager. Valid values: `bundler`, `composer`, `maven`, `npm`, `pip` or `yarn`. |
+| `package_manager` | string array | no | Returns dependencies belonging to specified package manager. Valid values: `bundler`, `composer`, `conan`, `maven`, `npm`, `pip` or `yarn`. |
```shell
curl --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/4/dependencies"
diff --git a/doc/api/discussions.md b/doc/api/discussions.md
index 9e9b9dcc901..1c22f261e57 100644
--- a/doc/api/discussions.md
+++ b/doc/api/discussions.md
@@ -1214,13 +1214,13 @@ Parameters:
| Attribute | Type | Required | Description |
| ------------------------- | -------------- | -------- | ----------- |
| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) |
-| `commit_id` | integer | yes | The ID of a commit |
+| `commit_id` | string | yes | The SHA of a commit |
| `body` | string | yes | The content of the thread |
| `created_at` | string | no | Date time string, ISO 8601 formatted, such as `2016-03-11T03:45:40Z` (requires administrator or project/group owner rights) |
| `position` | hash | no | Position when creating a diff note |
-| `position[base_sha]` | string | yes | Base commit SHA in the source branch |
-| `position[start_sha]` | string | yes | SHA referencing commit in target branch |
-| `position[head_sha]` | string | yes | SHA referencing HEAD of this commit |
+| `position[base_sha]` | string | yes | SHA of the parent commit|
+| `position[start_sha]` | string | yes | SHA of the parent commit |
+| `position[head_sha]` | string | yes | The SHA of this commit (same as `commit_id`) |
| `position[position_type]` | string | yes | Type of the position reference', allowed values: `text` or `image` |
| `position[new_path]` | string | no | File path after change |
| `position[new_line]` | integer | no | Line number after change |
@@ -1235,6 +1235,10 @@ Parameters:
curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/5/commits/11/discussions?body=comment"
```
+The rules for creating the API request are the same as when
+[creating a new thread in the merge request diff](#create-a-new-thread-in-the-merge-request-diff),
+with the exception of `base_sha`, `start_sha`, and `head_sha` attributes.
+
### Add note to existing commit thread
Adds a new note to the thread.
diff --git a/doc/api/dora4_group_analytics.md b/doc/api/dora4_group_analytics.md
deleted file mode 100644
index 501bf824f03..00000000000
--- a/doc/api/dora4_group_analytics.md
+++ /dev/null
@@ -1,9 +0,0 @@
----
-redirect_to: 'dora/metrics.md'
-remove_date: '2021-07-25'
----
-
-This document was moved to [another location](dora/metrics.md).
-
-<!-- This redirect file can be deleted after <2021-07-25>. -->
-<!-- Before deletion, see: https://docs.gitlab.com/ee/development/documentation/#move-or-rename-a-page -->
diff --git a/doc/api/environments.md b/doc/api/environments.md
index 25690cc099a..aa3697c54ac 100644
--- a/doc/api/environments.md
+++ b/doc/api/environments.md
@@ -231,6 +231,52 @@ DELETE /projects/:id/environments/:environment_id
curl --request DELETE --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/1/environments/1"
```
+## Delete multiple stopped review apps
+
+> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/296625) in GitLab 14.2.
+
+It schedules for deletion multiple environments that have already been
+[stopped](../ci/environments/index.md#stop-an-environment) and
+are [in the review app folder](../ci/review_apps/index.md).
+The actual deletion is performed after 1 week from the time of execution.
+
+```plaintext
+DELETE /projects/:id/environments/review_apps
+```
+
+| Attribute | Type | Required | Description |
+| --------- | ------- | -------- | --------------------- |
+| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
+| `before` | datetime | no | The date before which environments can be deleted. Defaults to 30 days ago. Expected in ISO 8601 format (`YYYY-MM-DDTHH:MM:SSZ`). |
+| `limit` | integer | no | Maximum number of environments to delete. Defaults to 100. |
+| `dry_run` | boolean | no | Defaults to `true` for safety reasons. It performs a dry run where no actual deletion will be performed. Set to `false` to actually delete the environment. |
+
+```shell
+curl --request DELETE --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/1/environments/review_apps"
+```
+
+Example response:
+
+```json
+{
+ "scheduled_entries": [
+ {
+ "id": 387,
+ "name": "review/023f1bce01229c686a73",
+ "slug": "review-023f1bce01-3uxznk",
+ "external_url": null
+ },
+ {
+ "id": 388,
+ "name": "review/85d4c26a388348d3c4c0",
+ "slug": "review-85d4c26a38-5giw1c",
+ "external_url": null
+ }
+ ],
+ "unprocessable_entries": []
+}
+```
+
## Stop an environment
It returns `200` if the environment was successfully stopped, and `404` if the environment does not exist.
diff --git a/doc/api/error_tracking.md b/doc/api/error_tracking.md
index fbfd2a69ef7..0fbb30ef364 100644
--- a/doc/api/error_tracking.md
+++ b/doc/api/error_tracking.md
@@ -34,7 +34,8 @@ Example response:
"active": true,
"project_name": "sample sentry project",
"sentry_external_url": "https://sentry.io/myawesomeproject/project",
- "api_url": "https://sentry.io/api/0/projects/myawesomeproject/project"
+ "api_url": "https://sentry.io/api/0/projects/myawesomeproject/project",
+ "integrated": false
}
```
@@ -46,10 +47,11 @@ The API allows you to enable or disable the Error Tracking settings for a projec
PATCH /projects/:id/error_tracking/settings
```
-| Attribute | Type | Required | Description |
-| --------- | ------- | -------- | --------------------- |
-| `id` | integer | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
-| `active` | boolean | yes | Pass `true` to enable the already configured error tracking settings or `false` to disable it. |
+| Attribute | Type | Required | Description |
+| ------------ | ------- | -------- | --------------------- |
+| `id` | integer | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
+| `active` | boolean | yes | Pass `true` to enable the already configured error tracking settings or `false` to disable it. |
+| `integrated` | boolean | no | Pass `true` to enable the integrated error tracking backend. Available in [GitLab 14.2](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/68260) and later. |
```shell
curl --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/1/error_tracking/settings?active=true"
@@ -62,6 +64,7 @@ Example response:
"active": true,
"project_name": "sample sentry project",
"sentry_external_url": "https://sentry.io/myawesomeproject/project",
- "api_url": "https://sentry.io/api/0/projects/myawesomeproject/project"
+ "api_url": "https://sentry.io/api/0/projects/myawesomeproject/project",
+ "integrated": false
}
```
diff --git a/doc/api/events.md b/doc/api/events.md
index 7088eb65bd4..3fbbfa62e66 100644
--- a/doc/api/events.md
+++ b/doc/api/events.md
@@ -57,7 +57,7 @@ Available types for the `action` parameter, and the resources that might be affe
- Design
- Wiki page
-Note that these options are in lower case.
+These options are in lowercase.
### Target Types
@@ -71,7 +71,7 @@ Available target types for the `target_type` parameter are:
- `snippet`
- `user`
-Note that these options are in lower case.
+These options are in lowercase.
### Date formatting
@@ -83,7 +83,7 @@ YYYY-MM-DD
### Event Time Period Limit
-GitLab removes events older than 2 years from the events table for performance reasons.
+GitLab removes events older than 3 years from the events table for performance reasons.
## List currently authenticated user's events
diff --git a/doc/api/experiments.md b/doc/api/experiments.md
index 3c8efa35b78..c5e217a3d66 100644
--- a/doc/api/experiments.md
+++ b/doc/api/experiments.md
@@ -28,13 +28,51 @@ Example response:
```json
[
- {
- "key": "experiment_1",
- "enabled": true
+ {
+ "key": "code_quality_walkthrough",
+ "definition": {
+ "name": "code_quality_walkthrough",
+ "introduced_by_url": "https://gitlab.com/gitlab-org/gitlab/-/merge_requests/58900",
+ "rollout_issue_url": "https://gitlab.com/gitlab-org/gitlab/-/issues/327229",
+ "milestone": "13.12",
+ "type": "experiment",
+ "group": "group::activation",
+ "default_enabled": false
},
- {
- "key": "experiment_2",
- "enabled": false
+ "current_status": {
+ "state": "conditional",
+ "gates": [
+ {
+ "key": "boolean",
+ "value": false
+ },
+ {
+ "key": "percentage_of_actors",
+ "value": 25
+ }
+ ]
}
+ },
+ {
+ "key": "ci_runner_templates",
+ "definition": {
+ "name": "ci_runner_templates",
+ "introduced_by_url": "https://gitlab.com/gitlab-org/gitlab/-/merge_requests/58357",
+ "rollout_issue_url": "https://gitlab.com/gitlab-org/gitlab/-/issues/326725",
+ "milestone": "14.0",
+ "type": "experiment",
+ "group": "group::activation",
+ "default_enabled": false
+ },
+ "current_status": {
+ "state": "off",
+ "gates": [
+ {
+ "key": "boolean",
+ "value": false
+ }
+ ]
+ }
+ }
]
```
diff --git a/doc/api/features.md b/doc/api/features.md
index cb3ee04d076..87bd565e2bd 100644
--- a/doc/api/features.md
+++ b/doc/api/features.md
@@ -130,7 +130,7 @@ POST /features/:name
| `project` | string | no | A projects path, for example `gitlab-org/gitlab-foss` |
| `force` | boolean | no | Skip feature flag validation checks, such as a YAML definition |
-Note that you can enable or disable a feature for a `feature_group`, a `user`,
+You can enable or disable a feature for a `feature_group`, a `user`,
a `group`, and a `project` in a single API call.
```shell
diff --git a/doc/api/freeze_periods.md b/doc/api/freeze_periods.md
index 454d2dfb1c5..a562423b2af 100644
--- a/doc/api/freeze_periods.md
+++ b/doc/api/freeze_periods.md
@@ -122,7 +122,7 @@ Example response:
Update a Freeze Period for the given `freeze_period_id`.
```plaintext
-PUT /projects/:id/freeze_periods/:tag_name
+PUT /projects/:id/freeze_periods/:freeze_period_id
```
| Attribute | Type | Required | Description |
diff --git a/doc/api/graphql/audit_report.md b/doc/api/graphql/audit_report.md
index a68af6e8646..ba9967f85f2 100644
--- a/doc/api/graphql/audit_report.md
+++ b/doc/api/graphql/audit_report.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/graphql/custom_emoji.md b/doc/api/graphql/custom_emoji.md
index a4d0acda8e7..cb5c0275e08 100644
--- a/doc/api/graphql/custom_emoji.md
+++ b/doc/api/graphql/custom_emoji.md
@@ -13,7 +13,7 @@ info: To determine the technical writer assigned to the Stage/Group associated w
> - To use in GitLab self-managed instances, ask a GitLab administrator to [enable it](#enable-or-disable-custom-emoji-api). **(FREE SELF)**
This in-development feature might not be available for your use. There can be
-[risks when enabling features still in development](../../user/feature_flags.md#risks-when-enabling-features-still-in-development).
+[risks when enabling features still in development](../../administration/feature_flags.md#risks-when-enabling-features-still-in-development).
Refer to this feature's version history for more details.
To use custom emoji in comments and descriptions, you can add them to a group using the GraphQL API.
diff --git a/doc/api/graphql/getting_started.md b/doc/api/graphql/getting_started.md
index 5b482d15c51..e3cf81148c2 100644
--- a/doc/api/graphql/getting_started.md
+++ b/doc/api/graphql/getting_started.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/graphql/img/custom_emoji_query_example.png b/doc/api/graphql/img/custom_emoji_query_example.png
index 2caccd6cd10..4e289d23696 100644
--- a/doc/api/graphql/img/custom_emoji_query_example.png
+++ b/doc/api/graphql/img/custom_emoji_query_example.png
Binary files differ
diff --git a/doc/api/graphql/index.md b/doc/api/graphql/index.md
index b7a82dba7e9..e77e6102594 100644
--- a/doc/api/graphql/index.md
+++ b/doc/api/graphql/index.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/graphql/reference/index.md b/doc/api/graphql/reference/index.md
index db93accc86a..54709f56eb8 100644
--- a/doc/api/graphql/reference/index.md
+++ b/doc/api/graphql/reference/index.md
@@ -51,9 +51,19 @@ Returns [`CiConfig`](#ciconfig).
| ---- | ---- | ----------- |
| <a id="queryciconfigcontent"></a>`content` | [`String!`](#string) | Contents of `.gitlab-ci.yml`. |
| <a id="queryciconfigdryrun"></a>`dryRun` | [`Boolean`](#boolean) | Run pipeline creation simulation, or only do static check. |
-| <a id="queryciconfigprojectpath"></a>`projectPath` | [`ID!`](#id) | The project of the CI config. |
+| <a id="queryciconfigprojectpath"></a>`projectPath` | [`ID!`](#id) | Project of the CI config. |
| <a id="queryciconfigsha"></a>`sha` | [`String`](#string) | Sha for the pipeline. |
+### `Query.ciMinutesUsage`
+
+The monthly CI minutes usage data for the current user.
+
+Returns [`CiMinutesNamespaceMonthlyUsageConnection`](#ciminutesnamespacemonthlyusageconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
### `Query.containerRepository`
Find a container repository.
@@ -134,7 +144,7 @@ Returns [`Group`](#group).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="querygroupfullpath"></a>`fullPath` | [`ID!`](#id) | The full path of the project, group or namespace, e.g., `gitlab-org/gitlab-foss`. |
+| <a id="querygroupfullpath"></a>`fullPath` | [`ID!`](#id) | Full path of the project, group, or namespace. For example, `gitlab-org/gitlab-foss`. |
### `Query.instanceSecurityDashboard`
@@ -161,7 +171,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="queryinstancestatisticsmeasurementsidentifier"></a>`identifier` | [`MeasurementIdentifier!`](#measurementidentifier) | The type of measurement/statistics to retrieve. |
+| <a id="queryinstancestatisticsmeasurementsidentifier"></a>`identifier` | [`MeasurementIdentifier!`](#measurementidentifier) | Type of measurement or statistics to retrieve. |
| <a id="queryinstancestatisticsmeasurementsrecordedafter"></a>`recordedAfter` | [`Time`](#time) | Measurement recorded after this date. |
| <a id="queryinstancestatisticsmeasurementsrecordedbefore"></a>`recordedBefore` | [`Time`](#time) | Measurement recorded before this date. |
@@ -239,7 +249,7 @@ Returns [`Namespace`](#namespace).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="querynamespacefullpath"></a>`fullPath` | [`ID!`](#id) | The full path of the project, group or namespace, e.g., `gitlab-org/gitlab-foss`. |
+| <a id="querynamespacefullpath"></a>`fullPath` | [`ID!`](#id) | Full path of the project, group, or namespace. For example, `gitlab-org/gitlab-foss`. |
### `Query.package`
@@ -263,7 +273,7 @@ Returns [`Project`](#project).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="queryprojectfullpath"></a>`fullPath` | [`ID!`](#id) | The full path of the project, group or namespace, e.g., `gitlab-org/gitlab-foss`. |
+| <a id="queryprojectfullpath"></a>`fullPath` | [`ID!`](#id) | Full path of the project, group, or namespace. For example, `gitlab-org/gitlab-foss`. |
### `Query.projects`
@@ -368,7 +378,29 @@ four standard [pagination arguments](#connection-pagination-arguments):
| <a id="querysnippetsids"></a>`ids` | [`[SnippetID!]`](#snippetid) | Array of global snippet IDs. For example, `gid://gitlab/ProjectSnippet/1`. |
| <a id="querysnippetsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | The ID of a project. |
| <a id="querysnippetstype"></a>`type` | [`TypeEnum`](#typeenum) | The type of snippet. |
-| <a id="querysnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | The visibility of the snippet. |
+| <a id="querysnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | Visibility of the snippet. |
+
+### `Query.timelogs`
+
+Find timelogs visible to the current user.
+
+Returns [`TimelogConnection`](#timelogconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+#### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="querytimelogsenddate"></a>`endDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or before endDate. |
+| <a id="querytimelogsendtime"></a>`endTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or before endTime. |
+| <a id="querytimelogsgroupid"></a>`groupId` | [`GroupID`](#groupid) | List timelogs for a group. |
+| <a id="querytimelogsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | List timelogs for a project. |
+| <a id="querytimelogsstartdate"></a>`startDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or after startDate. |
+| <a id="querytimelogsstarttime"></a>`startTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or after startTime. |
+| <a id="querytimelogsusername"></a>`username` | [`String`](#string) | List timelogs for a user. |
### `Query.usageTrendsMeasurements`
@@ -384,7 +416,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="queryusagetrendsmeasurementsidentifier"></a>`identifier` | [`MeasurementIdentifier!`](#measurementidentifier) | The type of measurement/statistics to retrieve. |
+| <a id="queryusagetrendsmeasurementsidentifier"></a>`identifier` | [`MeasurementIdentifier!`](#measurementidentifier) | Type of measurement or statistics to retrieve. |
| <a id="queryusagetrendsmeasurementsrecordedafter"></a>`recordedAfter` | [`Time`](#time) | Measurement recorded after this date. |
| <a id="queryusagetrendsmeasurementsrecordedbefore"></a>`recordedBefore` | [`Time`](#time) | Measurement recorded before this date. |
@@ -447,7 +479,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
### `Query.vulnerabilitiesCountByDay`
-Number of vulnerabilities per day for the projects on the current user's instance security dashboard.
+The historical number of vulnerabilities per day for the projects on the current user's instance security dashboard.
Returns [`VulnerabilitiesCountByDayConnection`](#vulnerabilitiescountbydayconnection).
@@ -525,7 +557,7 @@ Input type: `AdminSidekiqQueuesDeleteJobsInput`
| <a id="mutationadminsidekiqqueuesdeletejobsclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationadminsidekiqqueuesdeletejobsfeaturecategory"></a>`featureCategory` | [`String`](#string) | Delete jobs matching feature_category in the context metadata. |
| <a id="mutationadminsidekiqqueuesdeletejobsproject"></a>`project` | [`String`](#string) | Delete jobs matching project in the context metadata. |
-| <a id="mutationadminsidekiqqueuesdeletejobsqueuename"></a>`queueName` | [`String!`](#string) | The name of the queue to delete jobs from. |
+| <a id="mutationadminsidekiqqueuesdeletejobsqueuename"></a>`queueName` | [`String!`](#string) | Name of the queue to delete jobs from. |
| <a id="mutationadminsidekiqqueuesdeletejobsrelatedclass"></a>`relatedClass` | [`String`](#string) | Delete jobs matching related_class in the context metadata. |
| <a id="mutationadminsidekiqqueuesdeletejobsremoteip"></a>`remoteIp` | [`String`](#string) | Delete jobs matching remote_ip in the context metadata. |
| <a id="mutationadminsidekiqqueuesdeletejobsrootnamespace"></a>`rootNamespace` | [`String`](#string) | Delete jobs matching root_namespace in the context metadata. |
@@ -548,21 +580,21 @@ Input type: `AlertSetAssigneesInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationalertsetassigneesassigneeusernames"></a>`assigneeUsernames` | [`[String!]!`](#string) | The usernames to assign to the alert. Replaces existing assignees by default. |
+| <a id="mutationalertsetassigneesassigneeusernames"></a>`assigneeUsernames` | [`[String!]!`](#string) | Usernames to assign to the alert. Replaces existing assignees by default. |
| <a id="mutationalertsetassigneesclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationalertsetassigneesiid"></a>`iid` | [`String!`](#string) | The IID of the alert to mutate. |
-| <a id="mutationalertsetassigneesoperationmode"></a>`operationMode` | [`MutationOperationMode`](#mutationoperationmode) | The operation to perform. Defaults to REPLACE. |
-| <a id="mutationalertsetassigneesprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the alert to mutate is in. |
+| <a id="mutationalertsetassigneesiid"></a>`iid` | [`String!`](#string) | IID of the alert to mutate. |
+| <a id="mutationalertsetassigneesoperationmode"></a>`operationMode` | [`MutationOperationMode`](#mutationoperationmode) | Operation to perform. Defaults to REPLACE. |
+| <a id="mutationalertsetassigneesprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the alert to mutate is in. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationalertsetassigneesalert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | The alert after mutation. |
+| <a id="mutationalertsetassigneesalert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | Alert after mutation. |
| <a id="mutationalertsetassigneesclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationalertsetassigneeserrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationalertsetassigneesissue"></a>`issue` | [`Issue`](#issue) | The issue created after mutation. |
-| <a id="mutationalertsetassigneestodo"></a>`todo` | [`Todo`](#todo) | The to-do item after mutation. |
+| <a id="mutationalertsetassigneesissue"></a>`issue` | [`Issue`](#issue) | Issue created after mutation. |
+| <a id="mutationalertsetassigneestodo"></a>`todo` | [`Todo`](#todo) | To-do item after mutation. |
### `Mutation.alertTodoCreate`
@@ -573,18 +605,18 @@ Input type: `AlertTodoCreateInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationalerttodocreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationalerttodocreateiid"></a>`iid` | [`String!`](#string) | The IID of the alert to mutate. |
-| <a id="mutationalerttodocreateprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the alert to mutate is in. |
+| <a id="mutationalerttodocreateiid"></a>`iid` | [`String!`](#string) | IID of the alert to mutate. |
+| <a id="mutationalerttodocreateprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the alert to mutate is in. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationalerttodocreatealert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | The alert after mutation. |
+| <a id="mutationalerttodocreatealert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | Alert after mutation. |
| <a id="mutationalerttodocreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationalerttodocreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationalerttodocreateissue"></a>`issue` | [`Issue`](#issue) | The issue created after mutation. |
-| <a id="mutationalerttodocreatetodo"></a>`todo` | [`Todo`](#todo) | The to-do item after mutation. |
+| <a id="mutationalerttodocreateissue"></a>`issue` | [`Issue`](#issue) | Issue created after mutation. |
+| <a id="mutationalerttodocreatetodo"></a>`todo` | [`Todo`](#todo) | To-do item after mutation. |
### `Mutation.apiFuzzingCiConfigurationCreate`
@@ -620,7 +652,7 @@ Input type: `AwardEmojiAddInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationawardemojiaddawardableid"></a>`awardableId` | [`AwardableID!`](#awardableid) | The global ID of the awardable resource. |
+| <a id="mutationawardemojiaddawardableid"></a>`awardableId` | [`AwardableID!`](#awardableid) | Global ID of the awardable resource. |
| <a id="mutationawardemojiaddclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationawardemojiaddname"></a>`name` | [`String!`](#string) | The emoji name. |
@@ -628,7 +660,7 @@ Input type: `AwardEmojiAddInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationawardemojiaddawardemoji"></a>`awardEmoji` | [`AwardEmoji`](#awardemoji) | The award emoji after mutation. |
+| <a id="mutationawardemojiaddawardemoji"></a>`awardEmoji` | [`AwardEmoji`](#awardemoji) | Award emoji after mutation. |
| <a id="mutationawardemojiaddclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationawardemojiadderrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -640,7 +672,7 @@ Input type: `AwardEmojiRemoveInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationawardemojiremoveawardableid"></a>`awardableId` | [`AwardableID!`](#awardableid) | The global ID of the awardable resource. |
+| <a id="mutationawardemojiremoveawardableid"></a>`awardableId` | [`AwardableID!`](#awardableid) | Global ID of the awardable resource. |
| <a id="mutationawardemojiremoveclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationawardemojiremovename"></a>`name` | [`String!`](#string) | The emoji name. |
@@ -648,7 +680,7 @@ Input type: `AwardEmojiRemoveInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationawardemojiremoveawardemoji"></a>`awardEmoji` | [`AwardEmoji`](#awardemoji) | The award emoji after mutation. |
+| <a id="mutationawardemojiremoveawardemoji"></a>`awardEmoji` | [`AwardEmoji`](#awardemoji) | Award emoji after mutation. |
| <a id="mutationawardemojiremoveclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationawardemojiremoveerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -660,7 +692,7 @@ Input type: `AwardEmojiToggleInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationawardemojitoggleawardableid"></a>`awardableId` | [`AwardableID!`](#awardableid) | The global ID of the awardable resource. |
+| <a id="mutationawardemojitoggleawardableid"></a>`awardableId` | [`AwardableID!`](#awardableid) | Global ID of the awardable resource. |
| <a id="mutationawardemojitoggleclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationawardemojitogglename"></a>`name` | [`String!`](#string) | The emoji name. |
@@ -668,7 +700,7 @@ Input type: `AwardEmojiToggleInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationawardemojitoggleawardemoji"></a>`awardEmoji` | [`AwardEmoji`](#awardemoji) | The award emoji after mutation. |
+| <a id="mutationawardemojitoggleawardemoji"></a>`awardEmoji` | [`AwardEmoji`](#awardemoji) | Award emoji after mutation. |
| <a id="mutationawardemojitoggleclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationawardemojitoggleerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
| <a id="mutationawardemojitoggletoggledon"></a>`toggledOn` | [`Boolean!`](#boolean) | Indicates the status of the emoji. True if the toggle awarded the emoji, and false if the toggle removed the emoji. |
@@ -782,7 +814,7 @@ Input type: `CiCdSettingsUpdateInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationcicdsettingsupdatecicdsettings"></a>`ciCdSettings` | [`ProjectCiCdSetting!`](#projectcicdsetting) | The CI/CD settings after mutation. |
+| <a id="mutationcicdsettingsupdatecicdsettings"></a>`ciCdSettings` | [`ProjectCiCdSetting!`](#projectcicdsetting) | CI/CD settings after mutation. |
| <a id="mutationcicdsettingsupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcicdsettingsupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -795,14 +827,14 @@ Input type: `CiJobTokenScopeAddProjectInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationcijobtokenscopeaddprojectclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcijobtokenscopeaddprojectprojectpath"></a>`projectPath` | [`ID!`](#id) | The project that the CI job token scope belongs to. |
-| <a id="mutationcijobtokenscopeaddprojecttargetprojectpath"></a>`targetProjectPath` | [`ID!`](#id) | The project to be added to the CI job token scope. |
+| <a id="mutationcijobtokenscopeaddprojectprojectpath"></a>`projectPath` | [`ID!`](#id) | Project that the CI job token scope belongs to. |
+| <a id="mutationcijobtokenscopeaddprojecttargetprojectpath"></a>`targetProjectPath` | [`ID!`](#id) | Project to be added to the CI job token scope. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationcijobtokenscopeaddprojectcijobtokenscope"></a>`ciJobTokenScope` | [`CiJobTokenScopeType`](#cijobtokenscopetype) | The CI job token's scope of access. |
+| <a id="mutationcijobtokenscopeaddprojectcijobtokenscope"></a>`ciJobTokenScope` | [`CiJobTokenScopeType`](#cijobtokenscopetype) | CI job token's scope of access. |
| <a id="mutationcijobtokenscopeaddprojectclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcijobtokenscopeaddprojecterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -815,14 +847,14 @@ Input type: `CiJobTokenScopeRemoveProjectInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationcijobtokenscoperemoveprojectclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcijobtokenscoperemoveprojectprojectpath"></a>`projectPath` | [`ID!`](#id) | The project that the CI job token scope belongs to. |
-| <a id="mutationcijobtokenscoperemoveprojecttargetprojectpath"></a>`targetProjectPath` | [`ID!`](#id) | The project to be removed from the CI job token scope. |
+| <a id="mutationcijobtokenscoperemoveprojectprojectpath"></a>`projectPath` | [`ID!`](#id) | Project that the CI job token scope belongs to. |
+| <a id="mutationcijobtokenscoperemoveprojecttargetprojectpath"></a>`targetProjectPath` | [`ID!`](#id) | Project to be removed from the CI job token scope. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationcijobtokenscoperemoveprojectcijobtokenscope"></a>`ciJobTokenScope` | [`CiJobTokenScopeType`](#cijobtokenscopetype) | The CI job token's scope of access. |
+| <a id="mutationcijobtokenscoperemoveprojectcijobtokenscope"></a>`ciJobTokenScope` | [`CiJobTokenScopeType`](#cijobtokenscopetype) | CI job token's scope of access. |
| <a id="mutationcijobtokenscoperemoveprojectclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcijobtokenscoperemoveprojecterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -904,7 +936,7 @@ Input type: `CommitCreateInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationcommitcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcommitcreatecommit"></a>`commit` | [`Commit`](#commit) | The commit after mutation. |
+| <a id="mutationcommitcreatecommit"></a>`commit` | [`Commit`](#commit) | Commit after mutation. |
| <a id="mutationcommitcreatecommitpipelinepath"></a>`commitPipelinePath` | [`String`](#string) | ETag path for the commit's pipeline. |
| <a id="mutationcommitcreatecontent"></a>`content` | [`[String!]`](#string) | Contents of the commit. |
| <a id="mutationcommitcreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -992,18 +1024,18 @@ Input type: `CreateAlertIssueInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationcreatealertissueclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcreatealertissueiid"></a>`iid` | [`String!`](#string) | The IID of the alert to mutate. |
-| <a id="mutationcreatealertissueprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the alert to mutate is in. |
+| <a id="mutationcreatealertissueiid"></a>`iid` | [`String!`](#string) | IID of the alert to mutate. |
+| <a id="mutationcreatealertissueprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the alert to mutate is in. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationcreatealertissuealert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | The alert after mutation. |
+| <a id="mutationcreatealertissuealert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | Alert after mutation. |
| <a id="mutationcreatealertissueclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreatealertissueerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationcreatealertissueissue"></a>`issue` | [`Issue`](#issue) | The issue created after mutation. |
-| <a id="mutationcreatealertissuetodo"></a>`todo` | [`Todo`](#todo) | The to-do item after mutation. |
+| <a id="mutationcreatealertissueissue"></a>`issue` | [`Issue`](#issue) | Issue created after mutation. |
+| <a id="mutationcreatealertissuetodo"></a>`todo` | [`Todo`](#todo) | To-do item after mutation. |
### `Mutation.createAnnotation`
@@ -1014,18 +1046,18 @@ Input type: `CreateAnnotationInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationcreateannotationclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcreateannotationclusterid"></a>`clusterId` | [`ClustersClusterID`](#clustersclusterid) | The global ID of the cluster to add an annotation to. |
-| <a id="mutationcreateannotationdashboardpath"></a>`dashboardPath` | [`String!`](#string) | The path to a file defining the dashboard on which the annotation should be added. |
-| <a id="mutationcreateannotationdescription"></a>`description` | [`String!`](#string) | The description of the annotation. |
+| <a id="mutationcreateannotationclusterid"></a>`clusterId` | [`ClustersClusterID`](#clustersclusterid) | Global ID of the cluster to add an annotation to. |
+| <a id="mutationcreateannotationdashboardpath"></a>`dashboardPath` | [`String!`](#string) | Path to a file defining the dashboard on which the annotation should be added. |
+| <a id="mutationcreateannotationdescription"></a>`description` | [`String!`](#string) | Description of the annotation. |
| <a id="mutationcreateannotationendingat"></a>`endingAt` | [`Time`](#time) | Timestamp indicating ending moment to which the annotation relates. |
-| <a id="mutationcreateannotationenvironmentid"></a>`environmentId` | [`EnvironmentID`](#environmentid) | The global ID of the environment to add an annotation to. |
+| <a id="mutationcreateannotationenvironmentid"></a>`environmentId` | [`EnvironmentID`](#environmentid) | Global ID of the environment to add an annotation to. |
| <a id="mutationcreateannotationstartingat"></a>`startingAt` | [`Time!`](#time) | Timestamp indicating starting moment to which the annotation relates. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationcreateannotationannotation"></a>`annotation` | [`MetricsDashboardAnnotation`](#metricsdashboardannotation) | The created annotation. |
+| <a id="mutationcreateannotationannotation"></a>`annotation` | [`MetricsDashboardAnnotation`](#metricsdashboardannotation) | Created annotation. |
| <a id="mutationcreateannotationclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreateannotationerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -1046,7 +1078,7 @@ Input type: `CreateBoardInput`
| <a id="mutationcreateboardlabelids"></a>`labelIds` | [`[LabelID!]`](#labelid) | IDs of labels to be added to the board. |
| <a id="mutationcreateboardlabels"></a>`labels` | [`[String!]`](#string) | Labels of the issue. |
| <a id="mutationcreateboardmilestoneid"></a>`milestoneId` | [`MilestoneID`](#milestoneid) | ID of milestone to be assigned to the board. |
-| <a id="mutationcreateboardname"></a>`name` | [`String`](#string) | The board name. |
+| <a id="mutationcreateboardname"></a>`name` | [`String`](#string) | Board name. |
| <a id="mutationcreateboardprojectpath"></a>`projectPath` | [`ID`](#id) | Full path of the project with which the resource is associated. |
| <a id="mutationcreateboardweight"></a>`weight` | [`Int`](#int) | Weight value to be assigned to the board. |
@@ -1054,7 +1086,7 @@ Input type: `CreateBoardInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationcreateboardboard"></a>`board` | [`Board`](#board) | The board after mutation. |
+| <a id="mutationcreateboardboard"></a>`board` | [`Board`](#board) | Board after mutation. |
| <a id="mutationcreateboardclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreateboarderrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -1139,7 +1171,7 @@ Input type: `CreateCustomEmojiInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationcreatecustomemojiclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcreatecustomemojicustomemoji"></a>`customEmoji` | [`CustomEmoji`](#customemoji) | The new custom emoji. |
+| <a id="mutationcreatecustomemojicustomemoji"></a>`customEmoji` | [`CustomEmoji`](#customemoji) | New custom emoji. |
| <a id="mutationcreatecustomemojierrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
### `Mutation.createDiffNote`
@@ -1152,8 +1184,8 @@ Input type: `CreateDiffNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationcreatediffnotebody"></a>`body` | [`String!`](#string) | Content of the note. |
| <a id="mutationcreatediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcreatediffnoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | The confidentiality flag of a note. Default is false. |
-| <a id="mutationcreatediffnotenoteableid"></a>`noteableId` | [`NoteableID!`](#noteableid) | The global ID of the resource to add a note to. |
+| <a id="mutationcreatediffnoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | Confidentiality flag of a note. Default is false. |
+| <a id="mutationcreatediffnotenoteableid"></a>`noteableId` | [`NoteableID!`](#noteableid) | Global ID of the resource to add a note to. |
| <a id="mutationcreatediffnoteposition"></a>`position` | [`DiffPositionInput!`](#diffpositioninput) | The position of this note on a diff. |
#### Fields
@@ -1162,7 +1194,7 @@ Input type: `CreateDiffNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationcreatediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreatediffnoteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationcreatediffnotenote"></a>`note` | [`Note`](#note) | The note after mutation. |
+| <a id="mutationcreatediffnotenote"></a>`note` | [`Note`](#note) | Note after mutation. |
### `Mutation.createEpic`
@@ -1202,8 +1234,8 @@ Input type: `CreateImageDiffNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationcreateimagediffnotebody"></a>`body` | [`String!`](#string) | Content of the note. |
| <a id="mutationcreateimagediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcreateimagediffnoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | The confidentiality flag of a note. Default is false. |
-| <a id="mutationcreateimagediffnotenoteableid"></a>`noteableId` | [`NoteableID!`](#noteableid) | The global ID of the resource to add a note to. |
+| <a id="mutationcreateimagediffnoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | Confidentiality flag of a note. Default is false. |
+| <a id="mutationcreateimagediffnotenoteableid"></a>`noteableId` | [`NoteableID!`](#noteableid) | Global ID of the resource to add a note to. |
| <a id="mutationcreateimagediffnoteposition"></a>`position` | [`DiffImagePositionInput!`](#diffimagepositioninput) | The position of this note on a diff. |
#### Fields
@@ -1212,7 +1244,7 @@ Input type: `CreateImageDiffNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationcreateimagediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreateimagediffnoteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationcreateimagediffnotenote"></a>`note` | [`Note`](#note) | The note after mutation. |
+| <a id="mutationcreateimagediffnotenote"></a>`note` | [`Note`](#note) | Note after mutation. |
### `Mutation.createIssue`
@@ -1222,21 +1254,21 @@ Input type: `CreateIssueInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationcreateissueassigneeids"></a>`assigneeIds` | [`[UserID!]`](#userid) | The array of user IDs to assign to the issue. |
+| <a id="mutationcreateissueassigneeids"></a>`assigneeIds` | [`[UserID!]`](#userid) | Array of user IDs to assign to the issue. |
| <a id="mutationcreateissueclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreateissueconfidential"></a>`confidential` | [`Boolean`](#boolean) | Indicates the issue is confidential. |
| <a id="mutationcreateissuecreatedat"></a>`createdAt` | [`Time`](#time) | Timestamp when the issue was created. Available only for admins and project owners. |
| <a id="mutationcreateissuedescription"></a>`description` | [`String`](#string) | Description of the issue. |
-| <a id="mutationcreateissuediscussiontoresolve"></a>`discussionToResolve` | [`String`](#string) | The ID of a discussion to resolve. Also pass `merge_request_to_resolve_discussions_of`. |
+| <a id="mutationcreateissuediscussiontoresolve"></a>`discussionToResolve` | [`String`](#string) | ID of a discussion to resolve. Also pass `merge_request_to_resolve_discussions_of`. |
| <a id="mutationcreateissueduedate"></a>`dueDate` | [`ISO8601Date`](#iso8601date) | Due date of the issue. |
| <a id="mutationcreateissueepicid"></a>`epicId` | [`EpicID`](#epicid) | The ID of an epic to associate the issue with. |
| <a id="mutationcreateissuehealthstatus"></a>`healthStatus` | [`HealthStatus`](#healthstatus) | The desired health status. |
-| <a id="mutationcreateissueiid"></a>`iid` | [`Int`](#int) | The IID (internal ID) of a project issue. Only admins and project owners can modify. |
-| <a id="mutationcreateissuelabelids"></a>`labelIds` | [`[LabelID!]`](#labelid) | The IDs of labels to be added to the issue. |
+| <a id="mutationcreateissueiid"></a>`iid` | [`Int`](#int) | IID (internal ID) of a project issue. Only admins and project owners can modify. |
+| <a id="mutationcreateissuelabelids"></a>`labelIds` | [`[LabelID!]`](#labelid) | IDs of labels to be added to the issue. |
| <a id="mutationcreateissuelabels"></a>`labels` | [`[String!]`](#string) | Labels of the issue. |
| <a id="mutationcreateissuelocked"></a>`locked` | [`Boolean`](#boolean) | Indicates discussion is locked on the issue. |
-| <a id="mutationcreateissuemergerequesttoresolvediscussionsof"></a>`mergeRequestToResolveDiscussionsOf` | [`MergeRequestID`](#mergerequestid) | The IID of a merge request for which to resolve discussions. |
-| <a id="mutationcreateissuemilestoneid"></a>`milestoneId` | [`MilestoneID`](#milestoneid) | The ID of the milestone to assign to the issue. On update milestone will be removed if set to null. |
+| <a id="mutationcreateissuemergerequesttoresolvediscussionsof"></a>`mergeRequestToResolveDiscussionsOf` | [`MergeRequestID`](#mergerequestid) | IID of a merge request for which to resolve discussions. |
+| <a id="mutationcreateissuemilestoneid"></a>`milestoneId` | [`MilestoneID`](#milestoneid) | ID of the milestone to assign to the issue. On update milestone will be removed if set to null. |
| <a id="mutationcreateissueprojectpath"></a>`projectPath` | [`ID!`](#id) | Project full path the issue is associated with. |
| <a id="mutationcreateissuetitle"></a>`title` | [`String!`](#string) | Title of the issue. |
| <a id="mutationcreateissuetype"></a>`type` | [`IssueType`](#issuetype) | Type of the issue. |
@@ -1248,7 +1280,7 @@ Input type: `CreateIssueInput`
| ---- | ---- | ----------- |
| <a id="mutationcreateissueclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreateissueerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationcreateissueissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationcreateissueissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.createIteration`
@@ -1289,9 +1321,9 @@ Input type: `CreateNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationcreatenotebody"></a>`body` | [`String!`](#string) | Content of the note. |
| <a id="mutationcreatenoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationcreatenoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | The confidentiality flag of a note. Default is false. |
-| <a id="mutationcreatenotediscussionid"></a>`discussionId` | [`DiscussionID`](#discussionid) | The global ID of the discussion this note is in reply to. |
-| <a id="mutationcreatenotenoteableid"></a>`noteableId` | [`NoteableID!`](#noteableid) | The global ID of the resource to add a note to. |
+| <a id="mutationcreatenoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | Confidentiality flag of a note. Default is false. |
+| <a id="mutationcreatenotediscussionid"></a>`discussionId` | [`DiscussionID`](#discussionid) | Global ID of the discussion this note is in reply to. |
+| <a id="mutationcreatenotenoteableid"></a>`noteableId` | [`NoteableID!`](#noteableid) | Global ID of the resource to add a note to. |
#### Fields
@@ -1299,7 +1331,7 @@ Input type: `CreateNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationcreatenoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreatenoteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationcreatenotenote"></a>`note` | [`Note`](#note) | The note after mutation. |
+| <a id="mutationcreatenotenote"></a>`note` | [`Note`](#note) | Note after mutation. |
### `Mutation.createRequirement`
@@ -1334,11 +1366,11 @@ Input type: `CreateSnippetInput`
| <a id="mutationcreatesnippetcaptcharesponse"></a>`captchaResponse` **{warning-solid}** | [`String`](#string) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
| <a id="mutationcreatesnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreatesnippetdescription"></a>`description` | [`String`](#string) | Description of the snippet. |
-| <a id="mutationcreatesnippetprojectpath"></a>`projectPath` | [`ID`](#id) | The project full path the snippet is associated with. |
+| <a id="mutationcreatesnippetprojectpath"></a>`projectPath` | [`ID`](#id) | Full path of the project the snippet is associated with. |
| <a id="mutationcreatesnippetspamlogid"></a>`spamLogId` **{warning-solid}** | [`Int`](#int) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
| <a id="mutationcreatesnippettitle"></a>`title` | [`String!`](#string) | Title of the snippet. |
-| <a id="mutationcreatesnippetuploadedfiles"></a>`uploadedFiles` | [`[String!]`](#string) | The paths to files uploaded in the snippet description. |
-| <a id="mutationcreatesnippetvisibilitylevel"></a>`visibilityLevel` | [`VisibilityLevelsEnum!`](#visibilitylevelsenum) | The visibility level of the snippet. |
+| <a id="mutationcreatesnippetuploadedfiles"></a>`uploadedFiles` | [`[String!]`](#string) | Paths to files uploaded in the snippet description. |
+| <a id="mutationcreatesnippetvisibilitylevel"></a>`visibilityLevel` | [`VisibilityLevelsEnum!`](#visibilitylevelsenum) | Visibility level of the snippet. |
#### Fields
@@ -1348,7 +1380,7 @@ Input type: `CreateSnippetInput`
| <a id="mutationcreatesnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationcreatesnippeterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
| <a id="mutationcreatesnippetneedscaptcharesponse"></a>`needsCaptchaResponse` **{warning-solid}** | [`Boolean`](#boolean) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
-| <a id="mutationcreatesnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | The snippet after mutation. |
+| <a id="mutationcreatesnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | Snippet after mutation. |
| <a id="mutationcreatesnippetspam"></a>`spam` **{warning-solid}** | [`Boolean`](#boolean) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
| <a id="mutationcreatesnippetspamlogid"></a>`spamLogId` **{warning-solid}** | [`Int`](#int) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
@@ -1717,9 +1749,9 @@ Input type: `DesignManagementDeleteInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdesignmanagementdeleteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdesignmanagementdeletefilenames"></a>`filenames` | [`[String!]!`](#string) | The filenames of the designs to delete. |
-| <a id="mutationdesignmanagementdeleteiid"></a>`iid` | [`ID!`](#id) | The IID of the issue to modify designs for. |
-| <a id="mutationdesignmanagementdeleteprojectpath"></a>`projectPath` | [`ID!`](#id) | The project where the issue is to upload designs for. |
+| <a id="mutationdesignmanagementdeletefilenames"></a>`filenames` | [`[String!]!`](#string) | Filenames of the designs to delete. |
+| <a id="mutationdesignmanagementdeleteiid"></a>`iid` | [`ID!`](#id) | IID of the issue to modify designs for. |
+| <a id="mutationdesignmanagementdeleteprojectpath"></a>`projectPath` | [`ID!`](#id) | Project where the issue is to upload designs for. |
#### Fields
@@ -1727,7 +1759,7 @@ Input type: `DesignManagementDeleteInput`
| ---- | ---- | ----------- |
| <a id="mutationdesignmanagementdeleteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationdesignmanagementdeleteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationdesignmanagementdeleteversion"></a>`version` | [`DesignVersion`](#designversion) | The new version in which the designs are deleted. |
+| <a id="mutationdesignmanagementdeleteversion"></a>`version` | [`DesignVersion`](#designversion) | New version in which the designs are deleted. |
### `Mutation.designManagementMove`
@@ -1747,7 +1779,7 @@ Input type: `DesignManagementMoveInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdesignmanagementmoveclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdesignmanagementmovedesigncollection"></a>`designCollection` | [`DesignCollection`](#designcollection) | The current state of the collection. |
+| <a id="mutationdesignmanagementmovedesigncollection"></a>`designCollection` | [`DesignCollection`](#designcollection) | Current state of the collection. |
| <a id="mutationdesignmanagementmoveerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
### `Mutation.designManagementUpload`
@@ -1759,16 +1791,16 @@ Input type: `DesignManagementUploadInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdesignmanagementuploadclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdesignmanagementuploadfiles"></a>`files` | [`[Upload!]!`](#upload) | The files to upload. |
-| <a id="mutationdesignmanagementuploadiid"></a>`iid` | [`ID!`](#id) | The IID of the issue to modify designs for. |
-| <a id="mutationdesignmanagementuploadprojectpath"></a>`projectPath` | [`ID!`](#id) | The project where the issue is to upload designs for. |
+| <a id="mutationdesignmanagementuploadfiles"></a>`files` | [`[Upload!]!`](#upload) | Files to upload. |
+| <a id="mutationdesignmanagementuploadiid"></a>`iid` | [`ID!`](#id) | IID of the issue to modify designs for. |
+| <a id="mutationdesignmanagementuploadprojectpath"></a>`projectPath` | [`ID!`](#id) | Project where the issue is to upload designs for. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdesignmanagementuploadclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdesignmanagementuploaddesigns"></a>`designs` | [`[Design!]!`](#design) | The designs that were uploaded by the mutation. |
+| <a id="mutationdesignmanagementuploaddesigns"></a>`designs` | [`[Design!]!`](#design) | Designs that were uploaded by the mutation. |
| <a id="mutationdesignmanagementuploaderrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
| <a id="mutationdesignmanagementuploadskippeddesigns"></a>`skippedDesigns` | [`[Design!]!`](#design) | Any designs that were skipped from the upload due to there being no change to their content since their last version. |
@@ -1781,13 +1813,13 @@ Input type: `DestroyBoardInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdestroyboardclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdestroyboardid"></a>`id` | [`BoardID!`](#boardid) | The global ID of the board to destroy. |
+| <a id="mutationdestroyboardid"></a>`id` | [`BoardID!`](#boardid) | Global ID of the board to destroy. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationdestroyboardboard"></a>`board` | [`Board`](#board) | The board after mutation. |
+| <a id="mutationdestroyboardboard"></a>`board` | [`Board`](#board) | Board after mutation. |
| <a id="mutationdestroyboardclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationdestroyboarderrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -1808,7 +1840,7 @@ Input type: `DestroyBoardListInput`
| ---- | ---- | ----------- |
| <a id="mutationdestroyboardlistclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationdestroyboardlisterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationdestroyboardlistlist"></a>`list` | [`BoardList`](#boardlist) | The list after mutation. |
+| <a id="mutationdestroyboardlistlist"></a>`list` | [`BoardList`](#boardlist) | List after mutation. |
### `Mutation.destroyComplianceFramework`
@@ -1844,7 +1876,7 @@ Input type: `DestroyContainerRepositoryInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdestroycontainerrepositoryclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdestroycontainerrepositorycontainerrepository"></a>`containerRepository` | [`ContainerRepository!`](#containerrepository) | The container repository policy after scheduling the deletion. |
+| <a id="mutationdestroycontainerrepositorycontainerrepository"></a>`containerRepository` | [`ContainerRepository!`](#containerrepository) | Container repository policy after scheduling the deletion. |
| <a id="mutationdestroycontainerrepositoryerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
### `Mutation.destroyContainerRepositoryTags`
@@ -1895,7 +1927,7 @@ Input type: `DestroyNoteInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdestroynoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdestroynoteid"></a>`id` | [`NoteID!`](#noteid) | The global ID of the note to destroy. |
+| <a id="mutationdestroynoteid"></a>`id` | [`NoteID!`](#noteid) | Global ID of the note to destroy. |
#### Fields
@@ -1903,7 +1935,7 @@ Input type: `DestroyNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationdestroynoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationdestroynoteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationdestroynotenote"></a>`note` | [`Note`](#note) | The note after mutation. |
+| <a id="mutationdestroynotenote"></a>`note` | [`Note`](#note) | Note after mutation. |
### `Mutation.destroyPackage`
@@ -1923,6 +1955,24 @@ Input type: `DestroyPackageInput`
| <a id="mutationdestroypackageclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationdestroypackageerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
+### `Mutation.destroyPackageFile`
+
+Input type: `DestroyPackageFileInput`
+
+#### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationdestroypackagefileclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationdestroypackagefileid"></a>`id` | [`PackagesPackageFileID!`](#packagespackagefileid) | ID of the Package file. |
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationdestroypackagefileclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationdestroypackagefileerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
+
### `Mutation.destroySnippet`
Input type: `DestroySnippetInput`
@@ -1932,7 +1982,7 @@ Input type: `DestroySnippetInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdestroysnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdestroysnippetid"></a>`id` | [`SnippetID!`](#snippetid) | The global ID of the snippet to destroy. |
+| <a id="mutationdestroysnippetid"></a>`id` | [`SnippetID!`](#snippetid) | Global ID of the snippet to destroy. |
#### Fields
@@ -1940,7 +1990,7 @@ Input type: `DestroySnippetInput`
| ---- | ---- | ----------- |
| <a id="mutationdestroysnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationdestroysnippeterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationdestroysnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | The snippet after mutation. |
+| <a id="mutationdestroysnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | Snippet after mutation. |
### `Mutation.disableDevopsAdoptionNamespace`
@@ -1973,7 +2023,7 @@ Input type: `DiscussionToggleResolveInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdiscussiontoggleresolveclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdiscussiontoggleresolveid"></a>`id` | [`DiscussionID!`](#discussionid) | The global ID of the discussion. |
+| <a id="mutationdiscussiontoggleresolveid"></a>`id` | [`DiscussionID!`](#discussionid) | Global ID of the discussion. |
| <a id="mutationdiscussiontoggleresolveresolve"></a>`resolve` | [`Boolean!`](#boolean) | Will resolve the discussion when true, and unresolve the discussion when false. |
#### Fields
@@ -1981,7 +2031,7 @@ Input type: `DiscussionToggleResolveInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationdiscussiontoggleresolveclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationdiscussiontoggleresolvediscussion"></a>`discussion` | [`Discussion`](#discussion) | The discussion after mutation. |
+| <a id="mutationdiscussiontoggleresolvediscussion"></a>`discussion` | [`Discussion`](#discussion) | Discussion after mutation. |
| <a id="mutationdiscussiontoggleresolveerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
### `Mutation.echoCreate`
@@ -2040,8 +2090,8 @@ Input type: `EnvironmentsCanaryIngressUpdateInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationenvironmentscanaryingressupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationenvironmentscanaryingressupdateid"></a>`id` | [`EnvironmentID!`](#environmentid) | The global ID of the environment to update. |
-| <a id="mutationenvironmentscanaryingressupdateweight"></a>`weight` | [`Int!`](#int) | The weight of the Canary Ingress. |
+| <a id="mutationenvironmentscanaryingressupdateid"></a>`id` | [`EnvironmentID!`](#environmentid) | Global ID of the environment to update. |
+| <a id="mutationenvironmentscanaryingressupdateweight"></a>`weight` | [`Int!`](#int) | Weight of the Canary Ingress. |
#### Fields
@@ -2087,7 +2137,7 @@ Input type: `EpicBoardCreateInput`
| <a id="mutationepicboardcreatehideclosedlist"></a>`hideClosedList` | [`Boolean`](#boolean) | Whether or not closed list is hidden. |
| <a id="mutationepicboardcreatelabelids"></a>`labelIds` | [`[LabelID!]`](#labelid) | IDs of labels to be added to the board. |
| <a id="mutationepicboardcreatelabels"></a>`labels` | [`[String!]`](#string) | Labels of the issue. |
-| <a id="mutationepicboardcreatename"></a>`name` | [`String`](#string) | The board name. |
+| <a id="mutationepicboardcreatename"></a>`name` | [`String`](#string) | Board name. |
#### Fields
@@ -2153,7 +2203,7 @@ Input type: `EpicBoardUpdateInput`
| <a id="mutationepicboardupdateid"></a>`id` | [`BoardsEpicBoardID!`](#boardsepicboardid) | The epic board global ID. |
| <a id="mutationepicboardupdatelabelids"></a>`labelIds` | [`[LabelID!]`](#labelid) | IDs of labels to be added to the board. |
| <a id="mutationepicboardupdatelabels"></a>`labels` | [`[String!]`](#string) | Labels of the issue. |
-| <a id="mutationepicboardupdatename"></a>`name` | [`String`](#string) | The board name. |
+| <a id="mutationepicboardupdatename"></a>`name` | [`String`](#string) | Board name. |
#### Fields
@@ -2332,6 +2382,26 @@ Input type: `GitlabSubscriptionActivateInput`
| <a id="mutationgitlabsubscriptionactivateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
| <a id="mutationgitlabsubscriptionactivatelicense"></a>`license` | [`CurrentLicense`](#currentlicense) | The current license. |
+### `Mutation.groupUpdate`
+
+Input type: `GroupUpdateInput`
+
+#### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationgroupupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationgroupupdatefullpath"></a>`fullPath` | [`ID!`](#id) | Full path of the group that will be updated. |
+| <a id="mutationgroupupdatesharedrunnerssetting"></a>`sharedRunnersSetting` | [`SharedRunnersSetting!`](#sharedrunnerssetting) | Shared runners availability for the namespace and its descendants. |
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationgroupupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationgroupupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
+| <a id="mutationgroupupdategroup"></a>`group` | [`Group`](#group) | Group after update. |
+
### `Mutation.httpIntegrationCreate`
Input type: `HttpIntegrationCreateInput`
@@ -2342,10 +2412,10 @@ Input type: `HttpIntegrationCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationcreateactive"></a>`active` | [`Boolean!`](#boolean) | Whether the integration is receiving alerts. |
| <a id="mutationhttpintegrationcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationhttpintegrationcreatename"></a>`name` | [`String!`](#string) | The name of the integration. |
+| <a id="mutationhttpintegrationcreatename"></a>`name` | [`String!`](#string) | Name of the integration. |
| <a id="mutationhttpintegrationcreatepayloadattributemappings"></a>`payloadAttributeMappings` | [`[AlertManagementPayloadAlertFieldInput!]`](#alertmanagementpayloadalertfieldinput) | The custom mapping of GitLab alert attributes to fields from the payload_example. |
| <a id="mutationhttpintegrationcreatepayloadexample"></a>`payloadExample` | [`JsonString`](#jsonstring) | The example of an alert payload. |
-| <a id="mutationhttpintegrationcreateprojectpath"></a>`projectPath` | [`ID!`](#id) | The project to create the integration in. |
+| <a id="mutationhttpintegrationcreateprojectpath"></a>`projectPath` | [`ID!`](#id) | Project to create the integration in. |
#### Fields
@@ -2353,7 +2423,7 @@ Input type: `HttpIntegrationCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationhttpintegrationcreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationhttpintegrationcreateintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | The HTTP integration. |
+| <a id="mutationhttpintegrationcreateintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | HTTP integration. |
### `Mutation.httpIntegrationDestroy`
@@ -2364,7 +2434,7 @@ Input type: `HttpIntegrationDestroyInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationdestroyclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationhttpintegrationdestroyid"></a>`id` | [`AlertManagementHttpIntegrationID!`](#alertmanagementhttpintegrationid) | The ID of the integration to remove. |
+| <a id="mutationhttpintegrationdestroyid"></a>`id` | [`AlertManagementHttpIntegrationID!`](#alertmanagementhttpintegrationid) | ID of the integration to remove. |
#### Fields
@@ -2372,7 +2442,7 @@ Input type: `HttpIntegrationDestroyInput`
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationdestroyclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationhttpintegrationdestroyerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationhttpintegrationdestroyintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | The HTTP integration. |
+| <a id="mutationhttpintegrationdestroyintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | HTTP integration. |
### `Mutation.httpIntegrationResetToken`
@@ -2383,7 +2453,7 @@ Input type: `HttpIntegrationResetTokenInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationresettokenclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationhttpintegrationresettokenid"></a>`id` | [`AlertManagementHttpIntegrationID!`](#alertmanagementhttpintegrationid) | The ID of the integration to mutate. |
+| <a id="mutationhttpintegrationresettokenid"></a>`id` | [`AlertManagementHttpIntegrationID!`](#alertmanagementhttpintegrationid) | ID of the integration to mutate. |
#### Fields
@@ -2391,7 +2461,7 @@ Input type: `HttpIntegrationResetTokenInput`
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationresettokenclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationhttpintegrationresettokenerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationhttpintegrationresettokenintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | The HTTP integration. |
+| <a id="mutationhttpintegrationresettokenintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | HTTP integration. |
### `Mutation.httpIntegrationUpdate`
@@ -2403,8 +2473,8 @@ Input type: `HttpIntegrationUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationupdateactive"></a>`active` | [`Boolean`](#boolean) | Whether the integration is receiving alerts. |
| <a id="mutationhttpintegrationupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationhttpintegrationupdateid"></a>`id` | [`AlertManagementHttpIntegrationID!`](#alertmanagementhttpintegrationid) | The ID of the integration to mutate. |
-| <a id="mutationhttpintegrationupdatename"></a>`name` | [`String`](#string) | The name of the integration. |
+| <a id="mutationhttpintegrationupdateid"></a>`id` | [`AlertManagementHttpIntegrationID!`](#alertmanagementhttpintegrationid) | ID of the integration to mutate. |
+| <a id="mutationhttpintegrationupdatename"></a>`name` | [`String`](#string) | Name of the integration. |
| <a id="mutationhttpintegrationupdatepayloadattributemappings"></a>`payloadAttributeMappings` | [`[AlertManagementPayloadAlertFieldInput!]`](#alertmanagementpayloadalertfieldinput) | The custom mapping of GitLab alert attributes to fields from the payload_example. |
| <a id="mutationhttpintegrationupdatepayloadexample"></a>`payloadExample` | [`JsonString`](#jsonstring) | The example of an alert payload. |
@@ -2414,7 +2484,7 @@ Input type: `HttpIntegrationUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationhttpintegrationupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationhttpintegrationupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationhttpintegrationupdateintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | The HTTP integration. |
+| <a id="mutationhttpintegrationupdateintegration"></a>`integration` | [`AlertManagementHttpIntegration`](#alertmanagementhttpintegration) | HTTP integration. |
### `Mutation.issueMove`
@@ -2425,9 +2495,9 @@ Input type: `IssueMoveInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationissuemoveclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuemoveiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuemoveprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
-| <a id="mutationissuemovetargetprojectpath"></a>`targetProjectPath` | [`ID!`](#id) | The project to move the issue to. |
+| <a id="mutationissuemoveiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuemoveprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
+| <a id="mutationissuemovetargetprojectpath"></a>`targetProjectPath` | [`ID!`](#id) | Project to move the issue to. |
#### Fields
@@ -2435,7 +2505,7 @@ Input type: `IssueMoveInput`
| ---- | ---- | ----------- |
| <a id="mutationissuemoveclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuemoveerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuemoveissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuemoveissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueMoveList`
@@ -2447,7 +2517,7 @@ Input type: `IssueMoveListInput`
| ---- | ---- | ----------- |
| <a id="mutationissuemovelistboardid"></a>`boardId` | [`BoardID!`](#boardid) | Global ID of the board that the issue is in. |
| <a id="mutationissuemovelistclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuemovelistepicid"></a>`epicId` | [`EpicID`](#epicid) | The ID of the parent epic. NULL when removing the association. |
+| <a id="mutationissuemovelistepicid"></a>`epicId` | [`EpicID`](#epicid) | ID of the parent epic. NULL when removing the association. |
| <a id="mutationissuemovelistfromlistid"></a>`fromListId` | [`ID`](#id) | ID of the board list that the issue will be moved from. |
| <a id="mutationissuemovelistiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
| <a id="mutationissuemovelistmoveafterid"></a>`moveAfterId` | [`ID`](#id) | ID of issue that should be placed after the current issue. |
@@ -2461,7 +2531,7 @@ Input type: `IssueMoveListInput`
| ---- | ---- | ----------- |
| <a id="mutationissuemovelistclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuemovelisterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuemovelistissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuemovelistissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetAssignees`
@@ -2471,11 +2541,11 @@ Input type: `IssueSetAssigneesInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationissuesetassigneesassigneeusernames"></a>`assigneeUsernames` | [`[String!]!`](#string) | The usernames to assign to the resource. Replaces existing assignees by default. |
+| <a id="mutationissuesetassigneesassigneeusernames"></a>`assigneeUsernames` | [`[String!]!`](#string) | Usernames to assign to the resource. Replaces existing assignees by default. |
| <a id="mutationissuesetassigneesclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuesetassigneesiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuesetassigneesoperationmode"></a>`operationMode` | [`MutationOperationMode`](#mutationoperationmode) | The operation to perform. Defaults to REPLACE. |
-| <a id="mutationissuesetassigneesprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetassigneesiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuesetassigneesoperationmode"></a>`operationMode` | [`MutationOperationMode`](#mutationoperationmode) | Operation to perform. Defaults to REPLACE. |
+| <a id="mutationissuesetassigneesprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
#### Fields
@@ -2483,7 +2553,7 @@ Input type: `IssueSetAssigneesInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetassigneesclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetassigneeserrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetassigneesissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetassigneesissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetConfidential`
@@ -2495,8 +2565,8 @@ Input type: `IssueSetConfidentialInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetconfidentialclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetconfidentialconfidential"></a>`confidential` | [`Boolean!`](#boolean) | Whether or not to set the issue as a confidential. |
-| <a id="mutationissuesetconfidentialiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuesetconfidentialprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetconfidentialiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuesetconfidentialprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
#### Fields
@@ -2504,7 +2574,7 @@ Input type: `IssueSetConfidentialInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetconfidentialclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetconfidentialerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetconfidentialissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetconfidentialissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetDueDate`
@@ -2515,9 +2585,9 @@ Input type: `IssueSetDueDateInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationissuesetduedateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuesetduedateduedate"></a>`dueDate` | [`Time`](#time) | The desired due date for the issue, due date will be removed if absent or set to null. |
-| <a id="mutationissuesetduedateiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuesetduedateprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetduedateduedate"></a>`dueDate` | [`Time`](#time) | Desired due date for the issue. Due date is removed if null. |
+| <a id="mutationissuesetduedateiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuesetduedateprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
#### Fields
@@ -2525,7 +2595,7 @@ Input type: `IssueSetDueDateInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetduedateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetduedateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetduedateissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetduedateissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetEpic`
@@ -2537,8 +2607,8 @@ Input type: `IssueSetEpicInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetepicclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetepicepicid"></a>`epicId` | [`EpicID`](#epicid) | Global ID of the epic to be assigned to the issue, epic will be removed if absent or set to null. |
-| <a id="mutationissuesetepiciid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuesetepicprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetepiciid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuesetepicprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
#### Fields
@@ -2546,7 +2616,7 @@ Input type: `IssueSetEpicInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetepicclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetepicerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetepicissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetepicissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetIteration`
@@ -2557,9 +2627,9 @@ Input type: `IssueSetIterationInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationissuesetiterationclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuesetiterationiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
+| <a id="mutationissuesetiterationiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
| <a id="mutationissuesetiterationiterationid"></a>`iterationId` | [`IterationID`](#iterationid) | The iteration to assign to the issue. |
-| <a id="mutationissuesetiterationprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetiterationprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
#### Fields
@@ -2567,7 +2637,7 @@ Input type: `IssueSetIterationInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetiterationclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetiterationerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetiterationissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetiterationissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetLocked`
@@ -2578,9 +2648,9 @@ Input type: `IssueSetLockedInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationissuesetlockedclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuesetlockediid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
+| <a id="mutationissuesetlockediid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
| <a id="mutationissuesetlockedlocked"></a>`locked` | [`Boolean!`](#boolean) | Whether or not to lock discussion on the issue. |
-| <a id="mutationissuesetlockedprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetlockedprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
#### Fields
@@ -2588,7 +2658,7 @@ Input type: `IssueSetLockedInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetlockedclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetlockederrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetlockedissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetlockedissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetSeverity`
@@ -2599,8 +2669,8 @@ Input type: `IssueSetSeverityInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationissuesetseverityclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuesetseverityiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuesetseverityprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetseverityiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuesetseverityprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
| <a id="mutationissuesetseverityseverity"></a>`severity` | [`IssuableSeverity!`](#issuableseverity) | Set the incident severity level. |
#### Fields
@@ -2609,7 +2679,7 @@ Input type: `IssueSetSeverityInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetseverityclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetseverityerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetseverityissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetseverityissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetSubscription`
@@ -2620,9 +2690,9 @@ Input type: `IssueSetSubscriptionInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationissuesetsubscriptionclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuesetsubscriptioniid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuesetsubscriptionprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
-| <a id="mutationissuesetsubscriptionsubscribedstate"></a>`subscribedState` | [`Boolean!`](#boolean) | The desired state of the subscription. |
+| <a id="mutationissuesetsubscriptioniid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuesetsubscriptionprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
+| <a id="mutationissuesetsubscriptionsubscribedstate"></a>`subscribedState` | [`Boolean!`](#boolean) | Desired state of the subscription. |
#### Fields
@@ -2630,7 +2700,7 @@ Input type: `IssueSetSubscriptionInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetsubscriptionclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetsubscriptionerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetsubscriptionissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetsubscriptionissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.issueSetWeight`
@@ -2641,8 +2711,8 @@ Input type: `IssueSetWeightInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationissuesetweightclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationissuesetweightiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationissuesetweightprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationissuesetweightiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationissuesetweightprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
| <a id="mutationissuesetweightweight"></a>`weight` | [`Int`](#int) | The desired weight for the issue. If set to null, weight is removed. |
#### Fields
@@ -2651,7 +2721,7 @@ Input type: `IssueSetWeightInput`
| ---- | ---- | ----------- |
| <a id="mutationissuesetweightclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationissuesetweighterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationissuesetweightissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationissuesetweightissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.iterationCadenceCreate`
@@ -2781,8 +2851,8 @@ Input type: `JiraImportStartInput`
| <a id="mutationjiraimportstartclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationjiraimportstartjiraprojectkey"></a>`jiraProjectKey` | [`String!`](#string) | Project key of the importer Jira project. |
| <a id="mutationjiraimportstartjiraprojectname"></a>`jiraProjectName` | [`String`](#string) | Project name of the importer Jira project. |
-| <a id="mutationjiraimportstartprojectpath"></a>`projectPath` | [`ID!`](#id) | The project to import the Jira project into. |
-| <a id="mutationjiraimportstartusersmapping"></a>`usersMapping` | [`[JiraUsersMappingInputType!]`](#jirausersmappinginputtype) | The mapping of Jira to GitLab users. |
+| <a id="mutationjiraimportstartprojectpath"></a>`projectPath` | [`ID!`](#id) | Project to import the Jira project into. |
+| <a id="mutationjiraimportstartusersmapping"></a>`usersMapping` | [`[JiraUsersMappingInputType!]`](#jirausersmappinginputtype) | Mapping of Jira to GitLab users. |
#### Fields
@@ -2790,7 +2860,7 @@ Input type: `JiraImportStartInput`
| ---- | ---- | ----------- |
| <a id="mutationjiraimportstartclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationjiraimportstarterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationjiraimportstartjiraimport"></a>`jiraImport` | [`JiraImport`](#jiraimport) | The Jira import data after mutation. |
+| <a id="mutationjiraimportstartjiraimport"></a>`jiraImport` | [`JiraImport`](#jiraimport) | Jira import data after mutation. |
### `Mutation.jiraImportUsers`
@@ -2801,8 +2871,8 @@ Input type: `JiraImportUsersInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationjiraimportusersclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationjiraimportusersprojectpath"></a>`projectPath` | [`ID!`](#id) | The project to import the Jira users into. |
-| <a id="mutationjiraimportusersstartat"></a>`startAt` | [`Int`](#int) | The index of the record the import should started at, default 0 (50 records returned). |
+| <a id="mutationjiraimportusersprojectpath"></a>`projectPath` | [`ID!`](#id) | Project to import the Jira users into. |
+| <a id="mutationjiraimportusersstartat"></a>`startAt` | [`Int`](#int) | Index of the record the import should started at, default 0 (50 records returned). |
#### Fields
@@ -2812,6 +2882,25 @@ Input type: `JiraImportUsersInput`
| <a id="mutationjiraimportuserserrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
| <a id="mutationjiraimportusersjirausers"></a>`jiraUsers` | [`[JiraUser!]`](#jirauser) | Users returned from Jira, matched by email and name if possible. |
+### `Mutation.jobCancel`
+
+Input type: `JobCancelInput`
+
+#### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationjobcancelclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationjobcancelid"></a>`id` | [`CiBuildID!`](#cibuildid) | ID of the job to mutate. |
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationjobcancelclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationjobcancelerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
+| <a id="mutationjobcanceljob"></a>`job` | [`CiJob`](#cijob) | Job after the mutation. |
+
### `Mutation.jobPlay`
Input type: `JobPlayInput`
@@ -2821,7 +2910,7 @@ Input type: `JobPlayInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationjobplayclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationjobplayid"></a>`id` | [`CiBuildID!`](#cibuildid) | The ID of the job to mutate. |
+| <a id="mutationjobplayid"></a>`id` | [`CiBuildID!`](#cibuildid) | ID of the job to mutate. |
#### Fields
@@ -2829,7 +2918,7 @@ Input type: `JobPlayInput`
| ---- | ---- | ----------- |
| <a id="mutationjobplayclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationjobplayerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationjobplayjob"></a>`job` | [`CiJob`](#cijob) | The job after the mutation. |
+| <a id="mutationjobplayjob"></a>`job` | [`CiJob`](#cijob) | Job after the mutation. |
### `Mutation.jobRetry`
@@ -2840,7 +2929,7 @@ Input type: `JobRetryInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationjobretryclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationjobretryid"></a>`id` | [`CiBuildID!`](#cibuildid) | The ID of the job to mutate. |
+| <a id="mutationjobretryid"></a>`id` | [`CiBuildID!`](#cibuildid) | ID of the job to mutate. |
#### Fields
@@ -2848,7 +2937,26 @@ Input type: `JobRetryInput`
| ---- | ---- | ----------- |
| <a id="mutationjobretryclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationjobretryerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationjobretryjob"></a>`job` | [`CiJob`](#cijob) | The job after the mutation. |
+| <a id="mutationjobretryjob"></a>`job` | [`CiJob`](#cijob) | Job after the mutation. |
+
+### `Mutation.jobUnschedule`
+
+Input type: `JobUnscheduleInput`
+
+#### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationjobunscheduleclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationjobunscheduleid"></a>`id` | [`CiBuildID!`](#cibuildid) | ID of the job to mutate. |
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationjobunscheduleclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationjobunscheduleerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
+| <a id="mutationjobunschedulejob"></a>`job` | [`CiJob`](#cijob) | Job after the mutation. |
### `Mutation.labelCreate`
@@ -2871,7 +2979,7 @@ Input type: `LabelCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationlabelcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationlabelcreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationlabelcreatelabel"></a>`label` | [`Label`](#label) | The label after mutation. |
+| <a id="mutationlabelcreatelabel"></a>`label` | [`Label`](#label) | Label after mutation. |
### `Mutation.markAsSpamSnippet`
@@ -2882,7 +2990,7 @@ Input type: `MarkAsSpamSnippetInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationmarkasspamsnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmarkasspamsnippetid"></a>`id` | [`SnippetID!`](#snippetid) | The global ID of the snippet to update. |
+| <a id="mutationmarkasspamsnippetid"></a>`id` | [`SnippetID!`](#snippetid) | Global ID of the snippet to update. |
#### Fields
@@ -2890,7 +2998,7 @@ Input type: `MarkAsSpamSnippetInput`
| ---- | ---- | ----------- |
| <a id="mutationmarkasspamsnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmarkasspamsnippeterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmarkasspamsnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | The snippet after mutation. |
+| <a id="mutationmarkasspamsnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | Snippet after mutation. |
### `Mutation.mergeRequestAccept`
@@ -2906,9 +3014,9 @@ Input type: `MergeRequestAcceptInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestacceptclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestacceptcommitmessage"></a>`commitMessage` | [`String`](#string) | Custom merge commit message. |
-| <a id="mutationmergerequestacceptiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestacceptprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
-| <a id="mutationmergerequestacceptsha"></a>`sha` | [`String!`](#string) | The HEAD SHA at the time when this merge was requested. |
+| <a id="mutationmergerequestacceptiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestacceptprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
+| <a id="mutationmergerequestacceptsha"></a>`sha` | [`String!`](#string) | HEAD SHA at the time when this merge was requested. |
| <a id="mutationmergerequestacceptshouldremovesourcebranch"></a>`shouldRemoveSourceBranch` | [`Boolean`](#boolean) | Should the source branch be removed. |
| <a id="mutationmergerequestacceptsquash"></a>`squash` | [`Boolean`](#boolean) | Squash commits on the source branch before merge. |
| <a id="mutationmergerequestacceptsquashcommitmessage"></a>`squashCommitMessage` | [`String`](#string) | Custom squash commit message (if squash is true). |
@@ -2920,7 +3028,7 @@ Input type: `MergeRequestAcceptInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestacceptclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestaccepterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestacceptmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestacceptmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestCreate`
@@ -2944,7 +3052,7 @@ Input type: `MergeRequestCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestcreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestcreatemergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestcreatemergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestReviewerRereview`
@@ -2955,9 +3063,9 @@ Input type: `MergeRequestReviewerRereviewInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationmergerequestreviewerrereviewclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmergerequestreviewerrereviewiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestreviewerrereviewprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
-| <a id="mutationmergerequestreviewerrereviewuserid"></a>`userId` | [`UserID!`](#userid) | The user ID for the user that has been requested for a new review. |
+| <a id="mutationmergerequestreviewerrereviewiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestreviewerrereviewprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
+| <a id="mutationmergerequestreviewerrereviewuserid"></a>`userId` | [`UserID!`](#userid) | User ID for the user that has been requested for a new review. |
#### Fields
@@ -2965,7 +3073,7 @@ Input type: `MergeRequestReviewerRereviewInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestreviewerrereviewclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestreviewerrereviewerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestreviewerrereviewmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestreviewerrereviewmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestSetAssignees`
@@ -2975,11 +3083,11 @@ Input type: `MergeRequestSetAssigneesInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationmergerequestsetassigneesassigneeusernames"></a>`assigneeUsernames` | [`[String!]!`](#string) | The usernames to assign to the resource. Replaces existing assignees by default. |
+| <a id="mutationmergerequestsetassigneesassigneeusernames"></a>`assigneeUsernames` | [`[String!]!`](#string) | Usernames to assign to the resource. Replaces existing assignees by default. |
| <a id="mutationmergerequestsetassigneesclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmergerequestsetassigneesiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestsetassigneesoperationmode"></a>`operationMode` | [`MutationOperationMode`](#mutationoperationmode) | The operation to perform. Defaults to REPLACE. |
-| <a id="mutationmergerequestsetassigneesprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
+| <a id="mutationmergerequestsetassigneesiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestsetassigneesoperationmode"></a>`operationMode` | [`MutationOperationMode`](#mutationoperationmode) | Operation to perform. Defaults to REPLACE. |
+| <a id="mutationmergerequestsetassigneesprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
#### Fields
@@ -2987,7 +3095,7 @@ Input type: `MergeRequestSetAssigneesInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetassigneesclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetassigneeserrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestsetassigneesmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestsetassigneesmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestSetDraft`
@@ -2999,8 +3107,8 @@ Input type: `MergeRequestSetDraftInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetdraftclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetdraftdraft"></a>`draft` | [`Boolean!`](#boolean) | Whether or not to set the merge request as a draft. |
-| <a id="mutationmergerequestsetdraftiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestsetdraftprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
+| <a id="mutationmergerequestsetdraftiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestsetdraftprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
#### Fields
@@ -3008,7 +3116,7 @@ Input type: `MergeRequestSetDraftInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetdraftclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetdrafterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestsetdraftmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestsetdraftmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestSetLabels`
@@ -3019,10 +3127,10 @@ Input type: `MergeRequestSetLabelsInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetlabelsclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmergerequestsetlabelsiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestsetlabelslabelids"></a>`labelIds` | [`[LabelID!]!`](#labelid) | The Label IDs to set. Replaces existing labels by default. |
+| <a id="mutationmergerequestsetlabelsiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestsetlabelslabelids"></a>`labelIds` | [`[LabelID!]!`](#labelid) | Label IDs to set. Replaces existing labels by default. |
| <a id="mutationmergerequestsetlabelsoperationmode"></a>`operationMode` | [`MutationOperationMode`](#mutationoperationmode) | Changes the operation mode. Defaults to REPLACE. |
-| <a id="mutationmergerequestsetlabelsprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
+| <a id="mutationmergerequestsetlabelsprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
#### Fields
@@ -3030,7 +3138,7 @@ Input type: `MergeRequestSetLabelsInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetlabelsclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetlabelserrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestsetlabelsmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestsetlabelsmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestSetLocked`
@@ -3041,9 +3149,9 @@ Input type: `MergeRequestSetLockedInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetlockedclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmergerequestsetlockediid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
+| <a id="mutationmergerequestsetlockediid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
| <a id="mutationmergerequestsetlockedlocked"></a>`locked` | [`Boolean!`](#boolean) | Whether or not to lock the merge request. |
-| <a id="mutationmergerequestsetlockedprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
+| <a id="mutationmergerequestsetlockedprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
#### Fields
@@ -3051,7 +3159,7 @@ Input type: `MergeRequestSetLockedInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetlockedclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetlockederrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestsetlockedmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestsetlockedmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestSetMilestone`
@@ -3062,9 +3170,9 @@ Input type: `MergeRequestSetMilestoneInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetmilestoneclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmergerequestsetmilestoneiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestsetmilestonemilestoneid"></a>`milestoneId` | [`MilestoneID`](#milestoneid) | The milestone to assign to the merge request. |
-| <a id="mutationmergerequestsetmilestoneprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
+| <a id="mutationmergerequestsetmilestoneiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestsetmilestonemilestoneid"></a>`milestoneId` | [`MilestoneID`](#milestoneid) | Milestone to assign to the merge request. |
+| <a id="mutationmergerequestsetmilestoneprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
#### Fields
@@ -3072,7 +3180,7 @@ Input type: `MergeRequestSetMilestoneInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetmilestoneclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetmilestoneerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestsetmilestonemergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestsetmilestonemergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestSetSubscription`
@@ -3083,9 +3191,9 @@ Input type: `MergeRequestSetSubscriptionInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetsubscriptionclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmergerequestsetsubscriptioniid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestsetsubscriptionprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
-| <a id="mutationmergerequestsetsubscriptionsubscribedstate"></a>`subscribedState` | [`Boolean!`](#boolean) | The desired state of the subscription. |
+| <a id="mutationmergerequestsetsubscriptioniid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestsetsubscriptionprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
+| <a id="mutationmergerequestsetsubscriptionsubscribedstate"></a>`subscribedState` | [`Boolean!`](#boolean) | Desired state of the subscription. |
#### Fields
@@ -3093,7 +3201,7 @@ Input type: `MergeRequestSetSubscriptionInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetsubscriptionclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetsubscriptionerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestsetsubscriptionmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestsetsubscriptionmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestSetWip`
@@ -3108,8 +3216,8 @@ Input type: `MergeRequestSetWipInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetwipclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationmergerequestsetwipiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestsetwipprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
+| <a id="mutationmergerequestsetwipiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestsetwipprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
| <a id="mutationmergerequestsetwipwip"></a>`wip` | [`Boolean!`](#boolean) | Whether or not to set the merge request as a draft. |
#### Fields
@@ -3118,7 +3226,7 @@ Input type: `MergeRequestSetWipInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestsetwipclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestsetwiperrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestsetwipmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestsetwipmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.mergeRequestUpdate`
@@ -3132,9 +3240,9 @@ Input type: `MergeRequestUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestupdatedescription"></a>`description` | [`String`](#string) | Description of the merge request (Markdown rendered as HTML for caching). |
-| <a id="mutationmergerequestupdateiid"></a>`iid` | [`String!`](#string) | The IID of the merge request to mutate. |
-| <a id="mutationmergerequestupdateprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the merge request to mutate is in. |
-| <a id="mutationmergerequestupdatestate"></a>`state` | [`MergeRequestNewState`](#mergerequestnewstate) | The action to perform to change the state. |
+| <a id="mutationmergerequestupdateiid"></a>`iid` | [`String!`](#string) | IID of the merge request to mutate. |
+| <a id="mutationmergerequestupdateprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the merge request to mutate is in. |
+| <a id="mutationmergerequestupdatestate"></a>`state` | [`MergeRequestNewState`](#mergerequestnewstate) | Action to perform to change the state. |
| <a id="mutationmergerequestupdatetargetbranch"></a>`targetBranch` | [`String`](#string) | Target branch of the merge request. |
| <a id="mutationmergerequestupdatetitle"></a>`title` | [`String`](#string) | Title of the merge request. |
@@ -3144,7 +3252,7 @@ Input type: `MergeRequestUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationmergerequestupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationmergerequestupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationmergerequestupdatemergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request after mutation. |
+| <a id="mutationmergerequestupdatemergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | Merge request after mutation. |
### `Mutation.namespaceIncreaseStorageTemporarily`
@@ -3311,7 +3419,7 @@ Input type: `PipelineCancelInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationpipelinecancelclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationpipelinecancelid"></a>`id` | [`CiPipelineID!`](#cipipelineid) | The ID of the pipeline to mutate. |
+| <a id="mutationpipelinecancelid"></a>`id` | [`CiPipelineID!`](#cipipelineid) | ID of the pipeline to mutate. |
#### Fields
@@ -3329,7 +3437,7 @@ Input type: `PipelineDestroyInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationpipelinedestroyclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationpipelinedestroyid"></a>`id` | [`CiPipelineID!`](#cipipelineid) | The ID of the pipeline to mutate. |
+| <a id="mutationpipelinedestroyid"></a>`id` | [`CiPipelineID!`](#cipipelineid) | ID of the pipeline to mutate. |
#### Fields
@@ -3347,7 +3455,7 @@ Input type: `PipelineRetryInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationpipelineretryclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationpipelineretryid"></a>`id` | [`CiPipelineID!`](#cipipelineid) | The ID of the pipeline to mutate. |
+| <a id="mutationpipelineretryid"></a>`id` | [`CiPipelineID!`](#cipipelineid) | ID of the pipeline to mutate. |
#### Fields
@@ -3355,7 +3463,50 @@ Input type: `PipelineRetryInput`
| ---- | ---- | ----------- |
| <a id="mutationpipelineretryclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationpipelineretryerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationpipelineretrypipeline"></a>`pipeline` | [`Pipeline`](#pipeline) | The pipeline after mutation. |
+| <a id="mutationpipelineretrypipeline"></a>`pipeline` | [`Pipeline`](#pipeline) | Pipeline after mutation. |
+
+### `Mutation.projectSetComplianceFramework`
+
+Assign (or unset) a compliance framework to a project.
+
+Input type: `ProjectSetComplianceFrameworkInput`
+
+#### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationprojectsetcomplianceframeworkclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationprojectsetcomplianceframeworkcomplianceframeworkid"></a>`complianceFrameworkId` | [`ComplianceManagementFrameworkID`](#compliancemanagementframeworkid) | ID of the compliance framework to assign to the project. |
+| <a id="mutationprojectsetcomplianceframeworkprojectid"></a>`projectId` | [`ProjectID!`](#projectid) | ID of the project to change the compliance framework of. |
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationprojectsetcomplianceframeworkclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationprojectsetcomplianceframeworkerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
+| <a id="mutationprojectsetcomplianceframeworkproject"></a>`project` | [`Project`](#project) | Project after mutation. |
+
+### `Mutation.projectSetLocked`
+
+Input type: `ProjectSetLockedInput`
+
+#### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationprojectsetlockedclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationprojectsetlockedfilepath"></a>`filePath` | [`String!`](#string) | Full path to the file. |
+| <a id="mutationprojectsetlockedlock"></a>`lock` | [`Boolean!`](#boolean) | Whether or not to lock the file path. |
+| <a id="mutationprojectsetlockedprojectpath"></a>`projectPath` | [`ID!`](#id) | Full path of the project to mutate. |
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mutationprojectsetlockedclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
+| <a id="mutationprojectsetlockederrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
+| <a id="mutationprojectsetlockedproject"></a>`project` | [`Project`](#project) | Project after mutation. |
### `Mutation.prometheusIntegrationCreate`
@@ -3368,7 +3519,7 @@ Input type: `PrometheusIntegrationCreateInput`
| <a id="mutationprometheusintegrationcreateactive"></a>`active` | [`Boolean!`](#boolean) | Whether the integration is receiving alerts. |
| <a id="mutationprometheusintegrationcreateapiurl"></a>`apiUrl` | [`String!`](#string) | Endpoint at which Prometheus can be queried. |
| <a id="mutationprometheusintegrationcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationprometheusintegrationcreateprojectpath"></a>`projectPath` | [`ID!`](#id) | The project to create the integration in. |
+| <a id="mutationprometheusintegrationcreateprojectpath"></a>`projectPath` | [`ID!`](#id) | Project to create the integration in. |
#### Fields
@@ -3376,7 +3527,7 @@ Input type: `PrometheusIntegrationCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationprometheusintegrationcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationprometheusintegrationcreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationprometheusintegrationcreateintegration"></a>`integration` | [`AlertManagementPrometheusIntegration`](#alertmanagementprometheusintegration) | The newly created integration. |
+| <a id="mutationprometheusintegrationcreateintegration"></a>`integration` | [`AlertManagementPrometheusIntegration`](#alertmanagementprometheusintegration) | Newly created integration. |
### `Mutation.prometheusIntegrationResetToken`
@@ -3387,7 +3538,7 @@ Input type: `PrometheusIntegrationResetTokenInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationprometheusintegrationresettokenclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationprometheusintegrationresettokenid"></a>`id` | [`IntegrationsPrometheusID!`](#integrationsprometheusid) | The ID of the integration to mutate. |
+| <a id="mutationprometheusintegrationresettokenid"></a>`id` | [`IntegrationsPrometheusID!`](#integrationsprometheusid) | ID of the integration to mutate. |
#### Fields
@@ -3395,7 +3546,7 @@ Input type: `PrometheusIntegrationResetTokenInput`
| ---- | ---- | ----------- |
| <a id="mutationprometheusintegrationresettokenclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationprometheusintegrationresettokenerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationprometheusintegrationresettokenintegration"></a>`integration` | [`AlertManagementPrometheusIntegration`](#alertmanagementprometheusintegration) | The newly created integration. |
+| <a id="mutationprometheusintegrationresettokenintegration"></a>`integration` | [`AlertManagementPrometheusIntegration`](#alertmanagementprometheusintegration) | Newly created integration. |
### `Mutation.prometheusIntegrationUpdate`
@@ -3408,7 +3559,7 @@ Input type: `PrometheusIntegrationUpdateInput`
| <a id="mutationprometheusintegrationupdateactive"></a>`active` | [`Boolean`](#boolean) | Whether the integration is receiving alerts. |
| <a id="mutationprometheusintegrationupdateapiurl"></a>`apiUrl` | [`String`](#string) | Endpoint at which Prometheus can be queried. |
| <a id="mutationprometheusintegrationupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationprometheusintegrationupdateid"></a>`id` | [`IntegrationsPrometheusID!`](#integrationsprometheusid) | The ID of the integration to mutate. |
+| <a id="mutationprometheusintegrationupdateid"></a>`id` | [`IntegrationsPrometheusID!`](#integrationsprometheusid) | ID of the integration to mutate. |
#### Fields
@@ -3416,7 +3567,7 @@ Input type: `PrometheusIntegrationUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationprometheusintegrationupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationprometheusintegrationupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationprometheusintegrationupdateintegration"></a>`integration` | [`AlertManagementPrometheusIntegration`](#alertmanagementprometheusintegration) | The newly created integration. |
+| <a id="mutationprometheusintegrationupdateintegration"></a>`integration` | [`AlertManagementPrometheusIntegration`](#alertmanagementprometheusintegration) | Newly created integration. |
### `Mutation.promoteToEpic`
@@ -3428,8 +3579,8 @@ Input type: `PromoteToEpicInput`
| ---- | ---- | ----------- |
| <a id="mutationpromotetoepicclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationpromotetoepicgrouppath"></a>`groupPath` | [`ID`](#id) | The group the promoted epic will belong to. |
-| <a id="mutationpromotetoepiciid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
-| <a id="mutationpromotetoepicprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
+| <a id="mutationpromotetoepiciid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationpromotetoepicprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
#### Fields
@@ -3438,7 +3589,7 @@ Input type: `PromoteToEpicInput`
| <a id="mutationpromotetoepicclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationpromotetoepicepic"></a>`epic` | [`Epic`](#epic) | The epic after issue promotion. |
| <a id="mutationpromotetoepicerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationpromotetoepicissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationpromotetoepicissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.releaseAssetLinkCreate`
@@ -3462,7 +3613,7 @@ Input type: `ReleaseAssetLinkCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationreleaseassetlinkcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleaseassetlinkcreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationreleaseassetlinkcreatelink"></a>`link` | [`ReleaseAssetLink`](#releaseassetlink) | The asset link after mutation. |
+| <a id="mutationreleaseassetlinkcreatelink"></a>`link` | [`ReleaseAssetLink`](#releaseassetlink) | Asset link after mutation. |
### `Mutation.releaseAssetLinkDelete`
@@ -3481,7 +3632,7 @@ Input type: `ReleaseAssetLinkDeleteInput`
| ---- | ---- | ----------- |
| <a id="mutationreleaseassetlinkdeleteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleaseassetlinkdeleteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationreleaseassetlinkdeletelink"></a>`link` | [`ReleaseAssetLink`](#releaseassetlink) | The deleted release asset link. |
+| <a id="mutationreleaseassetlinkdeletelink"></a>`link` | [`ReleaseAssetLink`](#releaseassetlink) | Deleted release asset link. |
### `Mutation.releaseAssetLinkUpdate`
@@ -3494,7 +3645,7 @@ Input type: `ReleaseAssetLinkUpdateInput`
| <a id="mutationreleaseassetlinkupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleaseassetlinkupdatedirectassetpath"></a>`directAssetPath` | [`String`](#string) | Relative path for a direct asset link. |
| <a id="mutationreleaseassetlinkupdateid"></a>`id` | [`ReleasesLinkID!`](#releaseslinkid) | ID of the release asset link to update. |
-| <a id="mutationreleaseassetlinkupdatelinktype"></a>`linkType` | [`ReleaseAssetLinkType`](#releaseassetlinktype) | The type of the asset link. |
+| <a id="mutationreleaseassetlinkupdatelinktype"></a>`linkType` | [`ReleaseAssetLinkType`](#releaseassetlinktype) | Type of the asset link. |
| <a id="mutationreleaseassetlinkupdatename"></a>`name` | [`String`](#string) | Name of the asset link. |
| <a id="mutationreleaseassetlinkupdateurl"></a>`url` | [`String`](#string) | URL of the asset link. |
@@ -3504,7 +3655,7 @@ Input type: `ReleaseAssetLinkUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationreleaseassetlinkupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleaseassetlinkupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationreleaseassetlinkupdatelink"></a>`link` | [`ReleaseAssetLink`](#releaseassetlink) | The asset link after mutation. |
+| <a id="mutationreleaseassetlinkupdatelink"></a>`link` | [`ReleaseAssetLink`](#releaseassetlink) | Asset link after mutation. |
### `Mutation.releaseCreate`
@@ -3517,11 +3668,11 @@ Input type: `ReleaseCreateInput`
| <a id="mutationreleasecreateassets"></a>`assets` | [`ReleaseAssetsInput`](#releaseassetsinput) | Assets associated to the release. |
| <a id="mutationreleasecreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleasecreatedescription"></a>`description` | [`String`](#string) | Description (also known as "release notes") of the release. |
-| <a id="mutationreleasecreatemilestones"></a>`milestones` | [`[String!]`](#string) | The title of each milestone the release is associated with. GitLab Premium customers can specify group milestones. |
+| <a id="mutationreleasecreatemilestones"></a>`milestones` | [`[String!]`](#string) | Title of each milestone the release is associated with. GitLab Premium customers can specify group milestones. |
| <a id="mutationreleasecreatename"></a>`name` | [`String`](#string) | Name of the release. |
| <a id="mutationreleasecreateprojectpath"></a>`projectPath` | [`ID!`](#id) | Full path of the project the release is associated with. |
-| <a id="mutationreleasecreateref"></a>`ref` | [`String`](#string) | The commit SHA or branch name to use if creating a new tag. |
-| <a id="mutationreleasecreatereleasedat"></a>`releasedAt` | [`Time`](#time) | The date when the release will be/was ready. Defaults to the current time. |
+| <a id="mutationreleasecreateref"></a>`ref` | [`String`](#string) | Commit SHA or branch name to use if creating a new tag. |
+| <a id="mutationreleasecreatereleasedat"></a>`releasedAt` | [`Time`](#time) | Date and time for the release. Defaults to the current date and time. |
| <a id="mutationreleasecreatetagname"></a>`tagName` | [`String!`](#string) | Name of the tag to associate with the release. |
#### Fields
@@ -3530,7 +3681,7 @@ Input type: `ReleaseCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationreleasecreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleasecreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationreleasecreaterelease"></a>`release` | [`Release`](#release) | The release after mutation. |
+| <a id="mutationreleasecreaterelease"></a>`release` | [`Release`](#release) | Release after mutation. |
### `Mutation.releaseDelete`
@@ -3550,7 +3701,7 @@ Input type: `ReleaseDeleteInput`
| ---- | ---- | ----------- |
| <a id="mutationreleasedeleteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleasedeleteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationreleasedeleterelease"></a>`release` | [`Release`](#release) | The deleted release. |
+| <a id="mutationreleasedeleterelease"></a>`release` | [`Release`](#release) | Deleted release. |
### `Mutation.releaseUpdate`
@@ -3562,10 +3713,10 @@ Input type: `ReleaseUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationreleaseupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleaseupdatedescription"></a>`description` | [`String`](#string) | Description (release notes) of the release. |
-| <a id="mutationreleaseupdatemilestones"></a>`milestones` | [`[String!]`](#string) | The title of each milestone the release is associated with. GitLab Premium customers can specify group milestones. |
+| <a id="mutationreleaseupdatemilestones"></a>`milestones` | [`[String!]`](#string) | Title of each milestone the release is associated with. GitLab Premium customers can specify group milestones. |
| <a id="mutationreleaseupdatename"></a>`name` | [`String`](#string) | Name of the release. |
| <a id="mutationreleaseupdateprojectpath"></a>`projectPath` | [`ID!`](#id) | Full path of the project the release is associated with. |
-| <a id="mutationreleaseupdatereleasedat"></a>`releasedAt` | [`Time`](#time) | The release date. |
+| <a id="mutationreleaseupdatereleasedat"></a>`releasedAt` | [`Time`](#time) | Release date. |
| <a id="mutationreleaseupdatetagname"></a>`tagName` | [`String!`](#string) | Name of the tag associated with the release. |
#### Fields
@@ -3574,7 +3725,7 @@ Input type: `ReleaseUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationreleaseupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationreleaseupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationreleaseupdaterelease"></a>`release` | [`Release`](#release) | The release after mutation. |
+| <a id="mutationreleaseupdaterelease"></a>`release` | [`Release`](#release) | Release after mutation. |
### `Mutation.removeProjectFromSecurityDashboard`
@@ -3605,7 +3756,7 @@ Input type: `RepositionImageDiffNoteInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationrepositionimagediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationrepositionimagediffnoteid"></a>`id` | [`DiffNoteID!`](#diffnoteid) | The global ID of the DiffNote to update. |
+| <a id="mutationrepositionimagediffnoteid"></a>`id` | [`DiffNoteID!`](#diffnoteid) | Global ID of the DiffNote to update. |
| <a id="mutationrepositionimagediffnoteposition"></a>`position` | [`UpdateDiffImagePositionInput!`](#updatediffimagepositioninput) | The position of this note on a diff. |
#### Fields
@@ -3614,7 +3765,7 @@ Input type: `RepositionImageDiffNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationrepositionimagediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationrepositionimagediffnoteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationrepositionimagediffnotenote"></a>`note` | [`Note`](#note) | The note after mutation. |
+| <a id="mutationrepositionimagediffnotenote"></a>`note` | [`Note`](#note) | Note after mutation. |
### `Mutation.runnerDelete`
@@ -3664,7 +3815,7 @@ Input type: `RunnerUpdateInput`
| ---- | ---- | ----------- |
| <a id="mutationrunnerupdateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationrunnerupdateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationrunnerupdaterunner"></a>`runner` | [`CiRunner`](#cirunner) | The runner after mutation. |
+| <a id="mutationrunnerupdaterunner"></a>`runner` | [`CiRunner`](#cirunner) | Runner after mutation. |
### `Mutation.runnersRegistrationTokenReset`
@@ -3686,7 +3837,7 @@ Input type: `RunnersRegistrationTokenResetInput`
| ---- | ---- | ----------- |
| <a id="mutationrunnersregistrationtokenresetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationrunnersregistrationtokenreseterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationrunnersregistrationtokenresettoken"></a>`token` | [`String`](#string) | The runner token after mutation. |
+| <a id="mutationrunnersregistrationtokenresettoken"></a>`token` | [`String`](#string) | Runner token after mutation. |
### `Mutation.scanExecutionPolicyCommit`
@@ -3810,7 +3961,7 @@ Input type: `TodoCreateInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationtodocreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationtodocreatetargetid"></a>`targetId` | [`TodoableID!`](#todoableid) | The global ID of the to-do item's parent. Issues, merge requests, designs and epics are supported. |
+| <a id="mutationtodocreatetargetid"></a>`targetId` | [`TodoableID!`](#todoableid) | Global ID of the to-do item's parent. Issues, merge requests, designs, and epics are supported. |
#### Fields
@@ -3818,7 +3969,7 @@ Input type: `TodoCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationtodocreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationtodocreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationtodocreatetodo"></a>`todo` | [`Todo`](#todo) | The to-do item created. |
+| <a id="mutationtodocreatetodo"></a>`todo` | [`Todo`](#todo) | To-do item created. |
### `Mutation.todoMarkDone`
@@ -3829,7 +3980,7 @@ Input type: `TodoMarkDoneInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationtodomarkdoneclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationtodomarkdoneid"></a>`id` | [`TodoID!`](#todoid) | The global ID of the to-do item to mark as done. |
+| <a id="mutationtodomarkdoneid"></a>`id` | [`TodoID!`](#todoid) | Global ID of the to-do item to mark as done. |
#### Fields
@@ -3837,7 +3988,7 @@ Input type: `TodoMarkDoneInput`
| ---- | ---- | ----------- |
| <a id="mutationtodomarkdoneclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationtodomarkdoneerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationtodomarkdonetodo"></a>`todo` | [`Todo!`](#todo) | The requested to-do item. |
+| <a id="mutationtodomarkdonetodo"></a>`todo` | [`Todo!`](#todo) | Requested to-do item. |
### `Mutation.todoRestore`
@@ -3848,7 +3999,7 @@ Input type: `TodoRestoreInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationtodorestoreclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationtodorestoreid"></a>`id` | [`TodoID!`](#todoid) | The global ID of the to-do item to restore. |
+| <a id="mutationtodorestoreid"></a>`id` | [`TodoID!`](#todoid) | Global ID of the to-do item to restore. |
#### Fields
@@ -3856,7 +4007,7 @@ Input type: `TodoRestoreInput`
| ---- | ---- | ----------- |
| <a id="mutationtodorestoreclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationtodorestoreerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationtodorestoretodo"></a>`todo` | [`Todo!`](#todo) | The requested to-do item. |
+| <a id="mutationtodorestoretodo"></a>`todo` | [`Todo!`](#todo) | Requested to-do item. |
### `Mutation.todoRestoreMany`
@@ -3867,7 +4018,7 @@ Input type: `TodoRestoreManyInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationtodorestoremanyclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationtodorestoremanyids"></a>`ids` | [`[TodoID!]!`](#todoid) | The global IDs of the to-do items to restore (a maximum of 50 is supported at once). |
+| <a id="mutationtodorestoremanyids"></a>`ids` | [`[TodoID!]!`](#todoid) | Global IDs of the to-do items to restore (a maximum of 50 is supported at once). |
#### Fields
@@ -3904,19 +4055,19 @@ Input type: `UpdateAlertStatusInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationupdatealertstatusclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationupdatealertstatusiid"></a>`iid` | [`String!`](#string) | The IID of the alert to mutate. |
-| <a id="mutationupdatealertstatusprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the alert to mutate is in. |
-| <a id="mutationupdatealertstatusstatus"></a>`status` | [`AlertManagementStatus!`](#alertmanagementstatus) | The status to set the alert. |
+| <a id="mutationupdatealertstatusiid"></a>`iid` | [`String!`](#string) | IID of the alert to mutate. |
+| <a id="mutationupdatealertstatusprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the alert to mutate is in. |
+| <a id="mutationupdatealertstatusstatus"></a>`status` | [`AlertManagementStatus!`](#alertmanagementstatus) | Status to set the alert. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationupdatealertstatusalert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | The alert after mutation. |
+| <a id="mutationupdatealertstatusalert"></a>`alert` | [`AlertManagementAlert`](#alertmanagementalert) | Alert after mutation. |
| <a id="mutationupdatealertstatusclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdatealertstatuserrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationupdatealertstatusissue"></a>`issue` | [`Issue`](#issue) | The issue created after mutation. |
-| <a id="mutationupdatealertstatustodo"></a>`todo` | [`Todo`](#todo) | The to-do item after mutation. |
+| <a id="mutationupdatealertstatusissue"></a>`issue` | [`Issue`](#issue) | Issue created after mutation. |
+| <a id="mutationupdatealertstatustodo"></a>`todo` | [`Todo`](#todo) | To-do item after mutation. |
### `Mutation.updateBoard`
@@ -3930,19 +4081,19 @@ Input type: `UpdateBoardInput`
| <a id="mutationupdateboardclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdateboardhidebackloglist"></a>`hideBacklogList` | [`Boolean`](#boolean) | Whether or not backlog list is hidden. |
| <a id="mutationupdateboardhideclosedlist"></a>`hideClosedList` | [`Boolean`](#boolean) | Whether or not closed list is hidden. |
-| <a id="mutationupdateboardid"></a>`id` | [`BoardID!`](#boardid) | The board global ID. |
+| <a id="mutationupdateboardid"></a>`id` | [`BoardID!`](#boardid) | Board global ID. |
| <a id="mutationupdateboarditerationid"></a>`iterationId` | [`IterationID`](#iterationid) | ID of iteration to be assigned to the board. |
| <a id="mutationupdateboardlabelids"></a>`labelIds` | [`[LabelID!]`](#labelid) | IDs of labels to be added to the board. |
| <a id="mutationupdateboardlabels"></a>`labels` | [`[String!]`](#string) | Labels of the issue. |
| <a id="mutationupdateboardmilestoneid"></a>`milestoneId` | [`MilestoneID`](#milestoneid) | ID of milestone to be assigned to the board. |
-| <a id="mutationupdateboardname"></a>`name` | [`String`](#string) | The board name. |
+| <a id="mutationupdateboardname"></a>`name` | [`String`](#string) | Board name. |
| <a id="mutationupdateboardweight"></a>`weight` | [`Int`](#int) | Weight value to be assigned to the board. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationupdateboardboard"></a>`board` | [`Board`](#board) | The board after mutation. |
+| <a id="mutationupdateboardboard"></a>`board` | [`Board`](#board) | Board after mutation. |
| <a id="mutationupdateboardclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdateboarderrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
@@ -4023,14 +4174,14 @@ Input type: `UpdateContainerExpirationPolicyInput`
| <a id="mutationupdatecontainerexpirationpolicynameregex"></a>`nameRegex` | [`UntrustedRegexp`](#untrustedregexp) | Tags with names matching this regex pattern will expire. |
| <a id="mutationupdatecontainerexpirationpolicynameregexkeep"></a>`nameRegexKeep` | [`UntrustedRegexp`](#untrustedregexp) | Tags with names matching this regex pattern will be preserved. |
| <a id="mutationupdatecontainerexpirationpolicyolderthan"></a>`olderThan` | [`ContainerExpirationPolicyOlderThanEnum`](#containerexpirationpolicyolderthanenum) | Tags older that this will expire. |
-| <a id="mutationupdatecontainerexpirationpolicyprojectpath"></a>`projectPath` | [`ID!`](#id) | The project path where the container expiration policy is located. |
+| <a id="mutationupdatecontainerexpirationpolicyprojectpath"></a>`projectPath` | [`ID!`](#id) | Project path where the container expiration policy is located. |
#### Fields
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationupdatecontainerexpirationpolicyclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationupdatecontainerexpirationpolicycontainerexpirationpolicy"></a>`containerExpirationPolicy` | [`ContainerExpirationPolicy`](#containerexpirationpolicy) | The container expiration policy after mutation. |
+| <a id="mutationupdatecontainerexpirationpolicycontainerexpirationpolicy"></a>`containerExpirationPolicy` | [`ContainerExpirationPolicy`](#containerexpirationpolicy) | Container expiration policy after mutation. |
| <a id="mutationupdatecontainerexpirationpolicyerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
### `Mutation.updateEpic`
@@ -4099,7 +4250,7 @@ Input type: `UpdateImageDiffNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationupdateimagediffnotebody"></a>`body` | [`String`](#string) | Content of the note. |
| <a id="mutationupdateimagediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationupdateimagediffnoteid"></a>`id` | [`NoteID!`](#noteid) | The global ID of the note to update. |
+| <a id="mutationupdateimagediffnoteid"></a>`id` | [`NoteID!`](#noteid) | Global ID of the note to update. |
| <a id="mutationupdateimagediffnoteposition"></a>`position` | [`UpdateDiffImagePositionInput`](#updatediffimagepositioninput) | The position of this note on a diff. |
#### Fields
@@ -4108,7 +4259,7 @@ Input type: `UpdateImageDiffNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationupdateimagediffnoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdateimagediffnoteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationupdateimagediffnotenote"></a>`note` | [`Note`](#note) | The note after mutation. |
+| <a id="mutationupdateimagediffnotenote"></a>`note` | [`Note`](#note) | Note after mutation. |
### `Mutation.updateIssue`
@@ -4118,18 +4269,19 @@ Input type: `UpdateIssueInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="mutationupdateissueaddlabelids"></a>`addLabelIds` | [`[ID!]`](#id) | The IDs of labels to be added to the issue. |
+| <a id="mutationupdateissueaddlabelids"></a>`addLabelIds` | [`[ID!]`](#id) | IDs of labels to be added to the issue. |
| <a id="mutationupdateissueclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdateissueconfidential"></a>`confidential` | [`Boolean`](#boolean) | Indicates the issue is confidential. |
| <a id="mutationupdateissuedescription"></a>`description` | [`String`](#string) | Description of the issue. |
| <a id="mutationupdateissueduedate"></a>`dueDate` | [`ISO8601Date`](#iso8601date) | Due date of the issue. |
| <a id="mutationupdateissueepicid"></a>`epicId` | [`EpicID`](#epicid) | The ID of the parent epic. NULL when removing the association. |
| <a id="mutationupdateissuehealthstatus"></a>`healthStatus` | [`HealthStatus`](#healthstatus) | The desired health status. |
-| <a id="mutationupdateissueiid"></a>`iid` | [`String!`](#string) | The IID of the issue to mutate. |
+| <a id="mutationupdateissueiid"></a>`iid` | [`String!`](#string) | IID of the issue to mutate. |
+| <a id="mutationupdateissuelabelids"></a>`labelIds` | [`[ID!]`](#id) | IDs of labels to be set. Replaces existing issue labels. |
| <a id="mutationupdateissuelocked"></a>`locked` | [`Boolean`](#boolean) | Indicates discussion is locked on the issue. |
-| <a id="mutationupdateissuemilestoneid"></a>`milestoneId` | [`ID`](#id) | The ID of the milestone to assign to the issue. On update milestone will be removed if set to null. |
-| <a id="mutationupdateissueprojectpath"></a>`projectPath` | [`ID!`](#id) | The project the issue to mutate is in. |
-| <a id="mutationupdateissueremovelabelids"></a>`removeLabelIds` | [`[ID!]`](#id) | The IDs of labels to be removed from the issue. |
+| <a id="mutationupdateissuemilestoneid"></a>`milestoneId` | [`ID`](#id) | ID of the milestone to assign to the issue. On update milestone will be removed if set to null. |
+| <a id="mutationupdateissueprojectpath"></a>`projectPath` | [`ID!`](#id) | Project the issue to mutate is in. |
+| <a id="mutationupdateissueremovelabelids"></a>`removeLabelIds` | [`[ID!]`](#id) | IDs of labels to be removed from the issue. |
| <a id="mutationupdateissuestateevent"></a>`stateEvent` | [`IssueStateEvent`](#issuestateevent) | Close or reopen an issue. |
| <a id="mutationupdateissuetitle"></a>`title` | [`String`](#string) | Title of the issue. |
| <a id="mutationupdateissuetype"></a>`type` | [`IssueType`](#issuetype) | Type of the issue. |
@@ -4141,7 +4293,7 @@ Input type: `UpdateIssueInput`
| ---- | ---- | ----------- |
| <a id="mutationupdateissueclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdateissueerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationupdateissueissue"></a>`issue` | [`Issue`](#issue) | The issue after mutation. |
+| <a id="mutationupdateissueissue"></a>`issue` | [`Issue`](#issue) | Issue after mutation. |
### `Mutation.updateIteration`
@@ -4180,7 +4332,7 @@ Input type: `UpdateNamespacePackageSettingsInput`
| <a id="mutationupdatenamespacepackagesettingsgenericduplicatesallowed"></a>`genericDuplicatesAllowed` | [`Boolean`](#boolean) | Indicates whether duplicate generic packages are allowed for this namespace. |
| <a id="mutationupdatenamespacepackagesettingsmavenduplicateexceptionregex"></a>`mavenDuplicateExceptionRegex` | [`UntrustedRegexp`](#untrustedregexp) | When maven_duplicates_allowed is false, you can publish duplicate packages with names that match this regex. Otherwise, this setting has no effect. |
| <a id="mutationupdatenamespacepackagesettingsmavenduplicatesallowed"></a>`mavenDuplicatesAllowed` | [`Boolean`](#boolean) | Indicates whether duplicate Maven packages are allowed for this namespace. |
-| <a id="mutationupdatenamespacepackagesettingsnamespacepath"></a>`namespacePath` | [`ID!`](#id) | The namespace path where the namespace package setting is located. |
+| <a id="mutationupdatenamespacepackagesettingsnamespacepath"></a>`namespacePath` | [`ID!`](#id) | Namespace path where the namespace package setting is located. |
#### Fields
@@ -4188,7 +4340,7 @@ Input type: `UpdateNamespacePackageSettingsInput`
| ---- | ---- | ----------- |
| <a id="mutationupdatenamespacepackagesettingsclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdatenamespacepackagesettingserrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationupdatenamespacepackagesettingspackagesettings"></a>`packageSettings` | [`PackageSettings`](#packagesettings) | The namespace package setting after mutation. |
+| <a id="mutationupdatenamespacepackagesettingspackagesettings"></a>`packageSettings` | [`PackageSettings`](#packagesettings) | Namespace package setting after mutation. |
### `Mutation.updateNote`
@@ -4205,8 +4357,8 @@ Input type: `UpdateNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationupdatenotebody"></a>`body` | [`String`](#string) | Content of the note. |
| <a id="mutationupdatenoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationupdatenoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | The confidentiality flag of a note. Default is false. |
-| <a id="mutationupdatenoteid"></a>`id` | [`NoteID!`](#noteid) | The global ID of the note to update. |
+| <a id="mutationupdatenoteconfidential"></a>`confidential` | [`Boolean`](#boolean) | Confidentiality flag of a note. Default is false. |
+| <a id="mutationupdatenoteid"></a>`id` | [`NoteID!`](#noteid) | Global ID of the note to update. |
#### Fields
@@ -4214,7 +4366,7 @@ Input type: `UpdateNoteInput`
| ---- | ---- | ----------- |
| <a id="mutationupdatenoteclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdatenoteerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationupdatenotenote"></a>`note` | [`Note`](#note) | The note after mutation. |
+| <a id="mutationupdatenotenote"></a>`note` | [`Note`](#note) | Note after mutation. |
### `Mutation.updateRequirement`
@@ -4252,10 +4404,10 @@ Input type: `UpdateSnippetInput`
| <a id="mutationupdatesnippetcaptcharesponse"></a>`captchaResponse` **{warning-solid}** | [`String`](#string) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
| <a id="mutationupdatesnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdatesnippetdescription"></a>`description` | [`String`](#string) | Description of the snippet. |
-| <a id="mutationupdatesnippetid"></a>`id` | [`SnippetID!`](#snippetid) | The global ID of the snippet to update. |
+| <a id="mutationupdatesnippetid"></a>`id` | [`SnippetID!`](#snippetid) | Global ID of the snippet to update. |
| <a id="mutationupdatesnippetspamlogid"></a>`spamLogId` **{warning-solid}** | [`Int`](#int) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
| <a id="mutationupdatesnippettitle"></a>`title` | [`String`](#string) | Title of the snippet. |
-| <a id="mutationupdatesnippetvisibilitylevel"></a>`visibilityLevel` | [`VisibilityLevelsEnum`](#visibilitylevelsenum) | The visibility level of the snippet. |
+| <a id="mutationupdatesnippetvisibilitylevel"></a>`visibilityLevel` | [`VisibilityLevelsEnum`](#visibilitylevelsenum) | Visibility level of the snippet. |
#### Fields
@@ -4265,7 +4417,7 @@ Input type: `UpdateSnippetInput`
| <a id="mutationupdatesnippetclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationupdatesnippeterrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
| <a id="mutationupdatesnippetneedscaptcharesponse"></a>`needsCaptchaResponse` **{warning-solid}** | [`Boolean`](#boolean) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
-| <a id="mutationupdatesnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | The snippet after mutation. |
+| <a id="mutationupdatesnippetsnippet"></a>`snippet` | [`Snippet`](#snippet) | Snippet after mutation. |
| <a id="mutationupdatesnippetspam"></a>`spam` **{warning-solid}** | [`Boolean`](#boolean) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
| <a id="mutationupdatesnippetspamlogid"></a>`spamLogId` **{warning-solid}** | [`Int`](#int) | **Deprecated:** Use spam protection with HTTP headers instead. Deprecated in 13.11. |
@@ -4278,7 +4430,7 @@ Input type: `UserCalloutCreateInput`
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="mutationusercalloutcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
-| <a id="mutationusercalloutcreatefeaturename"></a>`featureName` | [`String!`](#string) | The feature name you want to dismiss the callout for. |
+| <a id="mutationusercalloutcreatefeaturename"></a>`featureName` | [`String!`](#string) | Feature name you want to dismiss the callout for. |
#### Fields
@@ -4286,7 +4438,7 @@ Input type: `UserCalloutCreateInput`
| ---- | ---- | ----------- |
| <a id="mutationusercalloutcreateclientmutationid"></a>`clientMutationId` | [`String`](#string) | A unique identifier for the client performing the mutation. |
| <a id="mutationusercalloutcreateerrors"></a>`errors` | [`[String!]!`](#string) | Errors encountered during execution of the mutation. |
-| <a id="mutationusercalloutcreateusercallout"></a>`userCallout` | [`UserCallout!`](#usercallout) | The user callout dismissed. |
+| <a id="mutationusercalloutcreateusercallout"></a>`userCallout` | [`UserCallout!`](#usercallout) | User callout dismissed. |
### `Mutation.vulnerabilityConfirm`
@@ -4836,6 +4988,52 @@ The edge type for [`CiJob`](#cijob).
| <a id="cijobedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
| <a id="cijobedgenode"></a>`node` | [`CiJob`](#cijob) | The item at the end of the edge. |
+#### `CiMinutesNamespaceMonthlyUsageConnection`
+
+The connection type for [`CiMinutesNamespaceMonthlyUsage`](#ciminutesnamespacemonthlyusage).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="ciminutesnamespacemonthlyusageconnectionedges"></a>`edges` | [`[CiMinutesNamespaceMonthlyUsageEdge]`](#ciminutesnamespacemonthlyusageedge) | A list of edges. |
+| <a id="ciminutesnamespacemonthlyusageconnectionnodes"></a>`nodes` | [`[CiMinutesNamespaceMonthlyUsage]`](#ciminutesnamespacemonthlyusage) | A list of nodes. |
+| <a id="ciminutesnamespacemonthlyusageconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
+
+#### `CiMinutesNamespaceMonthlyUsageEdge`
+
+The edge type for [`CiMinutesNamespaceMonthlyUsage`](#ciminutesnamespacemonthlyusage).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="ciminutesnamespacemonthlyusageedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
+| <a id="ciminutesnamespacemonthlyusageedgenode"></a>`node` | [`CiMinutesNamespaceMonthlyUsage`](#ciminutesnamespacemonthlyusage) | The item at the end of the edge. |
+
+#### `CiMinutesProjectMonthlyUsageConnection`
+
+The connection type for [`CiMinutesProjectMonthlyUsage`](#ciminutesprojectmonthlyusage).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="ciminutesprojectmonthlyusageconnectionedges"></a>`edges` | [`[CiMinutesProjectMonthlyUsageEdge]`](#ciminutesprojectmonthlyusageedge) | A list of edges. |
+| <a id="ciminutesprojectmonthlyusageconnectionnodes"></a>`nodes` | [`[CiMinutesProjectMonthlyUsage]`](#ciminutesprojectmonthlyusage) | A list of nodes. |
+| <a id="ciminutesprojectmonthlyusageconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
+
+#### `CiMinutesProjectMonthlyUsageEdge`
+
+The edge type for [`CiMinutesProjectMonthlyUsage`](#ciminutesprojectmonthlyusage).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="ciminutesprojectmonthlyusageedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
+| <a id="ciminutesprojectmonthlyusageedgenode"></a>`node` | [`CiMinutesProjectMonthlyUsage`](#ciminutesprojectmonthlyusage) | The item at the end of the edge. |
+
#### `CiRunnerConnection`
The connection type for [`CiRunner`](#cirunner).
@@ -5485,6 +5683,29 @@ The edge type for [`Event`](#event).
| <a id="eventedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
| <a id="eventedgenode"></a>`node` | [`Event`](#event) | The item at the end of the edge. |
+#### `GroupConnection`
+
+The connection type for [`Group`](#group).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="groupconnectionedges"></a>`edges` | [`[GroupEdge]`](#groupedge) | A list of edges. |
+| <a id="groupconnectionnodes"></a>`nodes` | [`[Group]`](#group) | A list of nodes. |
+| <a id="groupconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
+
+#### `GroupEdge`
+
+The edge type for [`Group`](#group).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="groupedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
+| <a id="groupedgenode"></a>`node` | [`Group`](#group) | The item at the end of the edge. |
+
#### `GroupMemberConnection`
The connection type for [`GroupMember`](#groupmember).
@@ -6054,6 +6275,29 @@ The connection type for [`Package`](#package).
| <a id="packageconnectionnodes"></a>`nodes` | [`[Package]`](#package) | A list of nodes. |
| <a id="packageconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
+#### `PackageDependencyLinkConnection`
+
+The connection type for [`PackageDependencyLink`](#packagedependencylink).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencylinkconnectionedges"></a>`edges` | [`[PackageDependencyLinkEdge]`](#packagedependencylinkedge) | A list of edges. |
+| <a id="packagedependencylinkconnectionnodes"></a>`nodes` | [`[PackageDependencyLink]`](#packagedependencylink) | A list of nodes. |
+| <a id="packagedependencylinkconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
+
+#### `PackageDependencyLinkEdge`
+
+The edge type for [`PackageDependencyLink`](#packagedependencylink).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencylinkedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
+| <a id="packagedependencylinkedgenode"></a>`node` | [`PackageDependencyLink`](#packagedependencylink) | The item at the end of the edge. |
+
#### `PackageEdge`
The edge type for [`Package`](#package).
@@ -6898,6 +7142,29 @@ The edge type for [`Todo`](#todo).
| <a id="todoedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
| <a id="todoedgenode"></a>`node` | [`Todo`](#todo) | The item at the end of the edge. |
+#### `TreeConnection`
+
+The connection type for [`Tree`](#tree).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="treeconnectionedges"></a>`edges` | [`[TreeEdge]`](#treeedge) | A list of edges. |
+| <a id="treeconnectionnodes"></a>`nodes` | [`[Tree]`](#tree) | A list of nodes. |
+| <a id="treeconnectionpageinfo"></a>`pageInfo` | [`PageInfo!`](#pageinfo) | Information to aid in pagination. |
+
+#### `TreeEdge`
+
+The edge type for [`Tree`](#tree).
+
+##### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="treeedgecursor"></a>`cursor` | [`String!`](#string) | A cursor for use in pagination. |
+| <a id="treeedgenode"></a>`node` | [`Tree`](#tree) | The item at the end of the edge. |
+
#### `TreeEntryConnection`
The connection type for [`TreeEntry`](#treeentry).
@@ -7795,6 +8062,25 @@ Represents the total number of issues and their weights for a particular day.
| ---- | ---- | ----------- |
| <a id="cijobtokenscopetypeprojects"></a>`projects` | [`ProjectConnection!`](#projectconnection) | Allow list of projects that can be accessed by CI Job tokens created by this project. (see [Connections](#connections)) |
+### `CiMinutesNamespaceMonthlyUsage`
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="ciminutesnamespacemonthlyusageminutes"></a>`minutes` | [`Int`](#int) | The total number of minutes used by all projects in the namespace. |
+| <a id="ciminutesnamespacemonthlyusagemonth"></a>`month` | [`String`](#string) | The month related to the usage data. |
+| <a id="ciminutesnamespacemonthlyusageprojects"></a>`projects` | [`CiMinutesProjectMonthlyUsageConnection`](#ciminutesprojectmonthlyusageconnection) | CI minutes usage data for projects in the namespace. (see [Connections](#connections)) |
+
+### `CiMinutesProjectMonthlyUsage`
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="ciminutesprojectmonthlyusageminutes"></a>`minutes` | [`Int`](#int) | The number of CI minutes used by the project in the month. |
+| <a id="ciminutesprojectmonthlyusagename"></a>`name` | [`String`](#string) | The name of the project. |
+
### `CiRunner`
#### Fields
@@ -8296,8 +8582,8 @@ four standard [pagination arguments](#connection-pagination-arguments):
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="designversionsearlierorequaltoid"></a>`earlierOrEqualToId` | [`DesignManagementVersionID`](#designmanagementversionid) | The Global ID of the most recent acceptable version. |
-| <a id="designversionsearlierorequaltosha"></a>`earlierOrEqualToSha` | [`String`](#string) | The SHA256 of the most recent acceptable version. |
+| <a id="designversionsearlierorequaltoid"></a>`earlierOrEqualToId` | [`DesignManagementVersionID`](#designmanagementversionid) | Global ID of the most recent acceptable version. |
+| <a id="designversionsearlierorequaltosha"></a>`earlierOrEqualToSha` | [`String`](#string) | SHA256 of the most recent acceptable version. |
### `DesignAtVersion`
@@ -8357,7 +8643,7 @@ Returns [`DesignAtVersion`](#designatversion).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="designcollectiondesignatversionid"></a>`id` | [`DesignManagementDesignAtVersionID!`](#designmanagementdesignatversionid) | The Global ID of the design at this version. |
+| <a id="designcollectiondesignatversionid"></a>`id` | [`DesignManagementDesignAtVersionID!`](#designmanagementdesignatversionid) | Global ID of the design at this version. |
##### `DesignCollection.designs`
@@ -8387,8 +8673,8 @@ Returns [`DesignVersion`](#designversion).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="designcollectionversionid"></a>`id` | [`DesignManagementVersionID`](#designmanagementversionid) | The Global ID of the version. |
-| <a id="designcollectionversionsha"></a>`sha` | [`String`](#string) | The SHA256 of a specific version. |
+| <a id="designcollectionversionid"></a>`id` | [`DesignManagementVersionID`](#designmanagementversionid) | Global ID of the version. |
+| <a id="designcollectionversionsha"></a>`sha` | [`String`](#string) | SHA256 of a specific version. |
##### `DesignCollection.versions`
@@ -8404,8 +8690,8 @@ four standard [pagination arguments](#connection-pagination-arguments):
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="designcollectionversionsearlierorequaltoid"></a>`earlierOrEqualToId` | [`DesignManagementVersionID`](#designmanagementversionid) | The Global ID of the most recent acceptable version. |
-| <a id="designcollectionversionsearlierorequaltosha"></a>`earlierOrEqualToSha` | [`String`](#string) | The SHA256 of the most recent acceptable version. |
+| <a id="designcollectionversionsearlierorequaltoid"></a>`earlierOrEqualToId` | [`DesignManagementVersionID`](#designmanagementversionid) | Global ID of the most recent acceptable version. |
+| <a id="designcollectionversionsearlierorequaltosha"></a>`earlierOrEqualToSha` | [`String`](#string) | SHA256 of the most recent acceptable version. |
### `DesignManagement`
@@ -8421,7 +8707,7 @@ Returns [`DesignAtVersion`](#designatversion).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="designmanagementdesignatversionid"></a>`id` | [`DesignManagementDesignAtVersionID!`](#designmanagementdesignatversionid) | The Global ID of the design at this version. |
+| <a id="designmanagementdesignatversionid"></a>`id` | [`DesignManagementDesignAtVersionID!`](#designmanagementdesignatversionid) | Global ID of the design at this version. |
##### `DesignManagement.version`
@@ -8433,7 +8719,7 @@ Returns [`DesignVersion`](#designversion).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="designmanagementversionid"></a>`id` | [`DesignManagementVersionID!`](#designmanagementversionid) | The Global ID of the version. |
+| <a id="designmanagementversionid"></a>`id` | [`DesignManagementVersionID!`](#designmanagementversionid) | Global ID of the version. |
### `DesignVersion`
@@ -8461,9 +8747,9 @@ Returns [`DesignAtVersion!`](#designatversion).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="designversiondesignatversiondesignid"></a>`designId` | [`DesignManagementDesignID`](#designmanagementdesignid) | The ID of a specific design. |
-| <a id="designversiondesignatversionfilename"></a>`filename` | [`String`](#string) | The filename of a specific design. |
-| <a id="designversiondesignatversionid"></a>`id` | [`DesignManagementDesignAtVersionID`](#designmanagementdesignatversionid) | The ID of the DesignAtVersion. |
+| <a id="designversiondesignatversiondesignid"></a>`designId` | [`DesignManagementDesignID`](#designmanagementdesignid) | ID of a specific design. |
+| <a id="designversiondesignatversionfilename"></a>`filename` | [`String`](#string) | Filename of a specific design. |
+| <a id="designversiondesignatversionid"></a>`id` | [`DesignManagementDesignAtVersionID`](#designmanagementdesignatversionid) | ID of the DesignAtVersion. |
##### `DesignVersion.designsAtVersion`
@@ -8942,6 +9228,7 @@ Relationship between an epic and an issue.
| <a id="epicissueiid"></a>`iid` | [`ID!`](#id) | Internal ID of the issue. |
| <a id="epicissueiteration"></a>`iteration` | [`Iteration`](#iteration) | Iteration of the issue. |
| <a id="epicissuelabels"></a>`labels` | [`LabelConnection`](#labelconnection) | Labels of the issue. (see [Connections](#connections)) |
+| <a id="epicissuemergerequestscount"></a>`mergeRequestsCount` | [`Int!`](#int) | Number of merge requests that close the issue on merge. |
| <a id="epicissuemetricimages"></a>`metricImages` | [`[MetricImage!]`](#metricimage) | Metric images associated to the issue. |
| <a id="epicissuemilestone"></a>`milestone` | [`Milestone`](#milestone) | Milestone of the issue. |
| <a id="epicissuemoved"></a>`moved` | [`Boolean`](#boolean) | Indicates if issue got moved from other project. |
@@ -9079,6 +9366,7 @@ Represents an escalation rule for an escalation policy.
| <a id="escalationruletypeid"></a>`id` | [`IncidentManagementEscalationRuleID`](#incidentmanagementescalationruleid) | ID of the escalation policy. |
| <a id="escalationruletypeoncallschedule"></a>`oncallSchedule` | [`IncidentManagementOncallSchedule`](#incidentmanagementoncallschedule) | The on-call schedule to notify. |
| <a id="escalationruletypestatus"></a>`status` | [`EscalationRuleStatus`](#escalationrulestatus) | The status required to prevent the rule from activating. |
+| <a id="escalationruletypeuser"></a>`user` | [`UserCore`](#usercore) | The user to notify. |
### `Event`
@@ -9294,6 +9582,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| <a id="grouprequiretwofactorauthentication"></a>`requireTwoFactorAuthentication` | [`Boolean`](#boolean) | Indicates if all users in this group are required to set up two-factor authentication. |
| <a id="grouprootstoragestatistics"></a>`rootStorageStatistics` | [`RootStorageStatistics`](#rootstoragestatistics) | Aggregated storage statistics of the namespace. Only available for root namespaces. |
| <a id="groupsharewithgrouplock"></a>`shareWithGroupLock` | [`Boolean`](#boolean) | Indicates if sharing a project with another group within this group is prevented. |
+| <a id="groupsharedrunnerssetting"></a>`sharedRunnersSetting` | [`SharedRunnersSetting`](#sharedrunnerssetting) | Shared runners availability for the namespace and its descendants. |
| <a id="groupstats"></a>`stats` | [`GroupStats`](#groupstats) | Group statistics. |
| <a id="groupstoragesizelimit"></a>`storageSizeLimit` | [`Float`](#float) | Total storage limit of the root namespace in bytes. |
| <a id="groupsubgroupcreationlevel"></a>`subgroupCreationLevel` | [`String`](#string) | The permission level required to create subgroups within the group. |
@@ -9318,7 +9607,7 @@ Returns [`Board`](#board).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="groupboardid"></a>`id` | [`BoardID!`](#boardid) | The board's ID. |
+| <a id="groupboardid"></a>`id` | [`BoardID!`](#boardid) | ID of the board. |
##### `Group.boards`
@@ -9385,6 +9674,24 @@ four standard [pagination arguments](#connection-pagination-arguments):
| <a id="groupcontainerrepositoriesname"></a>`name` | [`String`](#string) | Filter the container repositories by their name. |
| <a id="groupcontainerrepositoriessort"></a>`sort` | [`ContainerRepositorySort`](#containerrepositorysort) | Sort container repositories by this criteria. |
+##### `Group.descendantGroups`
+
+List of descendant groups of this group.
+
+Returns [`GroupConnection`](#groupconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+###### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="groupdescendantgroupsincludeparentdescendants"></a>`includeParentDescendants` | [`Boolean`](#boolean) | List of descendant groups of the parent group. |
+| <a id="groupdescendantgroupsowned"></a>`owned` | [`Boolean`](#boolean) | Limit result to groups owned by authenticated user. |
+| <a id="groupdescendantgroupssearch"></a>`search` | [`String`](#string) | Search query for group name or group full path. |
+
##### `Group.epic`
Find a single epic.
@@ -9506,6 +9813,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| <a id="groupissuesiterationwildcardid"></a>`iterationWildcardId` | [`IterationWildcardId`](#iterationwildcardid) | Filter by iteration ID wildcard. |
| <a id="groupissueslabelname"></a>`labelName` | [`[String]`](#string) | Labels applied to this issue. |
| <a id="groupissuesmilestonetitle"></a>`milestoneTitle` | [`[String]`](#string) | Milestone applied to this issue. |
+| <a id="groupissuesmilestonewildcardid"></a>`milestoneWildcardId` | [`MilestoneWildcardId`](#milestonewildcardid) | Filter issues by milestone ID wildcard. |
| <a id="groupissuesnot"></a>`not` | [`NegatedIssueFilterInput`](#negatedissuefilterinput) | Negated arguments. |
| <a id="groupissuessearch"></a>`search` | [`String`](#string) | Search query for issue title or description. |
| <a id="groupissuessort"></a>`sort` | [`IssueSort`](#issuesort) | Sort issues by this criteria. |
@@ -9700,10 +10008,13 @@ four standard [pagination arguments](#connection-pagination-arguments):
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="grouptimelogsenddate"></a>`endDate` | [`Time`](#time) | List time logs within a date range where the logged date is equal to or before endDate. |
-| <a id="grouptimelogsendtime"></a>`endTime` | [`Time`](#time) | List time-logs within a time range where the logged time is equal to or before endTime. |
-| <a id="grouptimelogsstartdate"></a>`startDate` | [`Time`](#time) | List time logs within a date range where the logged date is equal to or after startDate. |
-| <a id="grouptimelogsstarttime"></a>`startTime` | [`Time`](#time) | List time-logs within a time range where the logged time is equal to or after startTime. |
+| <a id="grouptimelogsenddate"></a>`endDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or before endDate. |
+| <a id="grouptimelogsendtime"></a>`endTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or before endTime. |
+| <a id="grouptimelogsgroupid"></a>`groupId` | [`GroupID`](#groupid) | List timelogs for a group. |
+| <a id="grouptimelogsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | List timelogs for a project. |
+| <a id="grouptimelogsstartdate"></a>`startDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or after startDate. |
+| <a id="grouptimelogsstarttime"></a>`startTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or after startTime. |
+| <a id="grouptimelogsusername"></a>`username` | [`String`](#string) | List timelogs for a user. |
##### `Group.vulnerabilities`
@@ -9731,7 +10042,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
##### `Group.vulnerabilitiesCountByDay`
-Number of vulnerabilities per day for the projects in the group and its subgroups.
+The historical number of vulnerabilities per day for the projects in the group and its subgroups.
Returns [`VulnerabilitiesCountByDayConnection`](#vulnerabilitiescountbydayconnection).
@@ -9996,6 +10307,7 @@ Returns [`VulnerabilitySeveritiesCount`](#vulnerabilityseveritiescount).
| <a id="issueiid"></a>`iid` | [`ID!`](#id) | Internal ID of the issue. |
| <a id="issueiteration"></a>`iteration` | [`Iteration`](#iteration) | Iteration of the issue. |
| <a id="issuelabels"></a>`labels` | [`LabelConnection`](#labelconnection) | Labels of the issue. (see [Connections](#connections)) |
+| <a id="issuemergerequestscount"></a>`mergeRequestsCount` | [`Int!`](#int) | Number of merge requests that close the issue on merge. |
| <a id="issuemetricimages"></a>`metricImages` | [`[MetricImage!]`](#metricimage) | Metric images associated to the issue. |
| <a id="issuemilestone"></a>`milestone` | [`Milestone`](#milestone) | Milestone of the issue. |
| <a id="issuemoved"></a>`moved` | [`Boolean`](#boolean) | Indicates if issue got moved from other project. |
@@ -10451,6 +10763,7 @@ A user assigned to a merge request.
| <a id="mergerequestassigneelocation"></a>`location` | [`String`](#string) | The location of the user. |
| <a id="mergerequestassigneemergerequestinteraction"></a>`mergeRequestInteraction` | [`UserMergeRequestInteraction`](#usermergerequestinteraction) | Details of this user's interactions with the merge request. |
| <a id="mergerequestassigneename"></a>`name` | [`String!`](#string) | Human-readable name of the user. |
+| <a id="mergerequestassigneenamespace"></a>`namespace` | [`Namespace`](#namespace) | Personal namespace of the user. |
| <a id="mergerequestassigneeprojectmemberships"></a>`projectMemberships` | [`ProjectMemberConnection`](#projectmemberconnection) | Project memberships of the user. (see [Connections](#connections)) |
| <a id="mergerequestassigneepublicemail"></a>`publicEmail` | [`String`](#string) | User's public email. |
| <a id="mergerequestassigneestate"></a>`state` | [`UserState!`](#userstate) | State of the user. |
@@ -10565,7 +10878,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="mergerequestassigneesnippetsids"></a>`ids` | [`[SnippetID!]`](#snippetid) | Array of global snippet IDs. For example, `gid://gitlab/ProjectSnippet/1`. |
| <a id="mergerequestassigneesnippetstype"></a>`type` | [`TypeEnum`](#typeenum) | The type of snippet. |
-| <a id="mergerequestassigneesnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | The visibility of the snippet. |
+| <a id="mergerequestassigneesnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | Visibility of the snippet. |
##### `MergeRequestAssignee.starredProjects`
@@ -10583,6 +10896,28 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="mergerequestassigneestarredprojectssearch"></a>`search` | [`String`](#string) | Search query. |
+##### `MergeRequestAssignee.timelogs`
+
+Time logged by the user.
+
+Returns [`TimelogConnection`](#timelogconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+###### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mergerequestassigneetimelogsenddate"></a>`endDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or before endDate. |
+| <a id="mergerequestassigneetimelogsendtime"></a>`endTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or before endTime. |
+| <a id="mergerequestassigneetimelogsgroupid"></a>`groupId` | [`GroupID`](#groupid) | List timelogs for a group. |
+| <a id="mergerequestassigneetimelogsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | List timelogs for a project. |
+| <a id="mergerequestassigneetimelogsstartdate"></a>`startDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or after startDate. |
+| <a id="mergerequestassigneetimelogsstarttime"></a>`startTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or after startTime. |
+| <a id="mergerequestassigneetimelogsusername"></a>`username` | [`String`](#string) | List timelogs for a user. |
+
##### `MergeRequestAssignee.todos`
To-do items of the user.
@@ -10657,6 +10992,7 @@ A user assigned to a merge request as a reviewer.
| <a id="mergerequestreviewerlocation"></a>`location` | [`String`](#string) | The location of the user. |
| <a id="mergerequestreviewermergerequestinteraction"></a>`mergeRequestInteraction` | [`UserMergeRequestInteraction`](#usermergerequestinteraction) | Details of this user's interactions with the merge request. |
| <a id="mergerequestreviewername"></a>`name` | [`String!`](#string) | Human-readable name of the user. |
+| <a id="mergerequestreviewernamespace"></a>`namespace` | [`Namespace`](#namespace) | Personal namespace of the user. |
| <a id="mergerequestreviewerprojectmemberships"></a>`projectMemberships` | [`ProjectMemberConnection`](#projectmemberconnection) | Project memberships of the user. (see [Connections](#connections)) |
| <a id="mergerequestreviewerpublicemail"></a>`publicEmail` | [`String`](#string) | User's public email. |
| <a id="mergerequestreviewerstate"></a>`state` | [`UserState!`](#userstate) | State of the user. |
@@ -10771,7 +11107,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="mergerequestreviewersnippetsids"></a>`ids` | [`[SnippetID!]`](#snippetid) | Array of global snippet IDs. For example, `gid://gitlab/ProjectSnippet/1`. |
| <a id="mergerequestreviewersnippetstype"></a>`type` | [`TypeEnum`](#typeenum) | The type of snippet. |
-| <a id="mergerequestreviewersnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | The visibility of the snippet. |
+| <a id="mergerequestreviewersnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | Visibility of the snippet. |
##### `MergeRequestReviewer.starredProjects`
@@ -10789,6 +11125,28 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="mergerequestreviewerstarredprojectssearch"></a>`search` | [`String`](#string) | Search query. |
+##### `MergeRequestReviewer.timelogs`
+
+Time logged by the user.
+
+Returns [`TimelogConnection`](#timelogconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+###### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="mergerequestreviewertimelogsenddate"></a>`endDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or before endDate. |
+| <a id="mergerequestreviewertimelogsendtime"></a>`endTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or before endTime. |
+| <a id="mergerequestreviewertimelogsgroupid"></a>`groupId` | [`GroupID`](#groupid) | List timelogs for a group. |
+| <a id="mergerequestreviewertimelogsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | List timelogs for a project. |
+| <a id="mergerequestreviewertimelogsstartdate"></a>`startDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or after startDate. |
+| <a id="mergerequestreviewertimelogsstarttime"></a>`startTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or after startTime. |
+| <a id="mergerequestreviewertimelogsusername"></a>`username` | [`String`](#string) | List timelogs for a user. |
+
##### `MergeRequestReviewer.todos`
To-do items of the user.
@@ -10932,6 +11290,7 @@ Contains statistics about a milestone.
| <a id="namespacerepositorysizeexcessprojectcount"></a>`repositorySizeExcessProjectCount` | [`Int!`](#int) | Number of projects in the root namespace where the repository size exceeds the limit. |
| <a id="namespacerequestaccessenabled"></a>`requestAccessEnabled` | [`Boolean`](#boolean) | Indicates if users can request access to namespace. |
| <a id="namespacerootstoragestatistics"></a>`rootStorageStatistics` | [`RootStorageStatistics`](#rootstoragestatistics) | Aggregated storage statistics of the namespace. Only available for root namespaces. |
+| <a id="namespacesharedrunnerssetting"></a>`sharedRunnersSetting` | [`SharedRunnersSetting`](#sharedrunnerssetting) | Shared runners availability for the namespace and its descendants. |
| <a id="namespacestoragesizelimit"></a>`storageSizeLimit` | [`Float`](#float) | Total storage limit of the root namespace in bytes. |
| <a id="namespacetemporarystorageincreaseendson"></a>`temporaryStorageIncreaseEndsOn` | [`Time`](#time) | Date until the temporary storage increase is active. |
| <a id="namespacetotalrepositorysize"></a>`totalRepositorySize` | [`Float`](#float) | Total repository size of all projects in the root namespace in bytes. |
@@ -11032,6 +11391,17 @@ Represents the network policy.
| <a id="notepermissionsrepositionnote"></a>`repositionNote` | [`Boolean!`](#boolean) | Indicates the user can perform `reposition_note` on this resource. |
| <a id="notepermissionsresolvenote"></a>`resolveNote` | [`Boolean!`](#boolean) | Indicates the user can perform `resolve_note` on this resource. |
+### `NugetDependencyLinkMetadata`
+
+Nuget dependency link metadata.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="nugetdependencylinkmetadataid"></a>`id` | [`PackagesNugetDependencyLinkMetadatumID!`](#packagesnugetdependencylinkmetadatumid) | ID of the metadatum. |
+| <a id="nugetdependencylinkmetadatatargetframework"></a>`targetFramework` | [`String!`](#string) | Target framework of the dependency link package. |
+
### `NugetMetadata`
Nuget metadata.
@@ -11103,6 +11473,31 @@ Represents a composer JSON file.
| <a id="packagecomposerjsontypetype"></a>`type` | [`String`](#string) | The type set in the Composer JSON file. |
| <a id="packagecomposerjsontypeversion"></a>`version` | [`String`](#string) | The version set in the Composer JSON file. |
+### `PackageDependency`
+
+Represents a package dependency.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencyid"></a>`id` | [`PackagesDependencyID!`](#packagesdependencyid) | ID of the dependency. |
+| <a id="packagedependencyname"></a>`name` | [`String!`](#string) | Name of the dependency. |
+| <a id="packagedependencyversionpattern"></a>`versionPattern` | [`String!`](#string) | Version pattern of the dependency. |
+
+### `PackageDependencyLink`
+
+Represents a package dependency link.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagedependencylinkdependency"></a>`dependency` | [`PackageDependency`](#packagedependency) | Dependency. |
+| <a id="packagedependencylinkdependencytype"></a>`dependencyType` | [`PackageDependencyType!`](#packagedependencytype) | Dependency type. |
+| <a id="packagedependencylinkid"></a>`id` | [`PackagesDependencyLinkID!`](#packagesdependencylinkid) | ID of the dependency link. |
+| <a id="packagedependencylinkmetadata"></a>`metadata` | [`DependencyLinkMetadata`](#dependencylinkmetadata) | Dependency link metadata. |
+
### `PackageDetailsType`
Represents a package details in the Package Registry. Note that this type is in beta and susceptible to changes.
@@ -11112,6 +11507,7 @@ Represents a package details in the Package Registry. Note that this type is in
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="packagedetailstypecreatedat"></a>`createdAt` | [`Time!`](#time) | Date of creation. |
+| <a id="packagedetailstypedependencylinks"></a>`dependencyLinks` | [`PackageDependencyLinkConnection`](#packagedependencylinkconnection) | Dependency link. (see [Connections](#connections)) |
| <a id="packagedetailstypeid"></a>`id` | [`PackagesPackageID!`](#packagespackageid) | ID of the package. |
| <a id="packagedetailstypemetadata"></a>`metadata` | [`PackageMetadata`](#packagemetadata) | Package metadata. |
| <a id="packagedetailstypename"></a>`name` | [`String!`](#string) | Name of the package. |
@@ -11371,6 +11767,7 @@ Represents vulnerability finding of a security report on the pipeline.
| ---- | ---- | ----------- |
| <a id="pipelinesecurityreportfindingconfidence"></a>`confidence` | [`String`](#string) | Type of the security report that found the vulnerability. |
| <a id="pipelinesecurityreportfindingdescription"></a>`description` | [`String`](#string) | Description of the vulnerability finding. |
+| <a id="pipelinesecurityreportfindingfalsepositive"></a>`falsePositive` | [`Boolean`](#boolean) | Indicates whether the vulnerability is a false positive. Available only when feature flag `vulnerability_flags` is enabled. This flag is disabled by default, because the feature is experimental and is subject to change without notice. |
| <a id="pipelinesecurityreportfindingidentifiers"></a>`identifiers` | [`[VulnerabilityIdentifier!]!`](#vulnerabilityidentifier) | Identifiers of the vulnerabilit finding. |
| <a id="pipelinesecurityreportfindinglocation"></a>`location` | [`VulnerabilityLocation`](#vulnerabilitylocation) | Location metadata for the vulnerability. Its fields depend on the type of security scan that found the vulnerability. |
| <a id="pipelinesecurityreportfindingname"></a>`name` | [`String`](#string) | Name of the vulnerability finding. |
@@ -11574,7 +11971,7 @@ Returns [`Board`](#board).
| Name | Type | Description |
| ---- | ---- | ----------- |
-| <a id="projectboardid"></a>`id` | [`BoardID!`](#boardid) | The board's ID. |
+| <a id="projectboardid"></a>`id` | [`BoardID!`](#boardid) | ID of the board. |
##### `Project.boards`
@@ -11633,6 +12030,18 @@ four standard [pagination arguments](#connection-pagination-arguments):
| <a id="projectcontainerrepositoriesname"></a>`name` | [`String`](#string) | Filter the container repositories by their name. |
| <a id="projectcontainerrepositoriessort"></a>`sort` | [`ContainerRepositorySort`](#containerrepositorysort) | Sort container repositories by this criteria. |
+##### `Project.dastProfile`
+
+DAST Profile associated with the project.
+
+Returns [`DastProfile`](#dastprofile).
+
+###### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="projectdastprofileid"></a>`id` | [`DastProfileID!`](#dastprofileid) | ID of the DAST Profile. |
+
##### `Project.dastSiteProfile`
DAST Site Profile associated with the project.
@@ -11746,6 +12155,7 @@ Returns [`Issue`](#issue).
| <a id="projectissueiterationwildcardid"></a>`iterationWildcardId` | [`IterationWildcardId`](#iterationwildcardid) | Filter by iteration ID wildcard. |
| <a id="projectissuelabelname"></a>`labelName` | [`[String]`](#string) | Labels applied to this issue. |
| <a id="projectissuemilestonetitle"></a>`milestoneTitle` | [`[String]`](#string) | Milestone applied to this issue. |
+| <a id="projectissuemilestonewildcardid"></a>`milestoneWildcardId` | [`MilestoneWildcardId`](#milestonewildcardid) | Filter issues by milestone ID wildcard. |
| <a id="projectissuenot"></a>`not` | [`NegatedIssueFilterInput`](#negatedissuefilterinput) | Negated arguments. |
| <a id="projectissuesearch"></a>`search` | [`String`](#string) | Search query for issue title or description. |
| <a id="projectissuesort"></a>`sort` | [`IssueSort`](#issuesort) | Sort issues by this criteria. |
@@ -11777,6 +12187,7 @@ Returns [`IssueStatusCountsType`](#issuestatuscountstype).
| <a id="projectissuestatuscountsiids"></a>`iids` | [`[String!]`](#string) | List of IIDs of issues. For example, `["1", "2"]`. |
| <a id="projectissuestatuscountslabelname"></a>`labelName` | [`[String]`](#string) | Labels applied to this issue. |
| <a id="projectissuestatuscountsmilestonetitle"></a>`milestoneTitle` | [`[String]`](#string) | Milestone applied to this issue. |
+| <a id="projectissuestatuscountsmilestonewildcardid"></a>`milestoneWildcardId` | [`MilestoneWildcardId`](#milestonewildcardid) | Filter issues by milestone ID wildcard. |
| <a id="projectissuestatuscountsnot"></a>`not` | [`NegatedIssueFilterInput`](#negatedissuefilterinput) | Negated arguments. |
| <a id="projectissuestatuscountssearch"></a>`search` | [`String`](#string) | Search query for issue title or description. |
| <a id="projectissuestatuscountstypes"></a>`types` | [`[IssueType!]`](#issuetype) | Filter issues by the given issue types. |
@@ -11812,6 +12223,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| <a id="projectissuesiterationwildcardid"></a>`iterationWildcardId` | [`IterationWildcardId`](#iterationwildcardid) | Filter by iteration ID wildcard. |
| <a id="projectissueslabelname"></a>`labelName` | [`[String]`](#string) | Labels applied to this issue. |
| <a id="projectissuesmilestonetitle"></a>`milestoneTitle` | [`[String]`](#string) | Milestone applied to this issue. |
+| <a id="projectissuesmilestonewildcardid"></a>`milestoneWildcardId` | [`MilestoneWildcardId`](#milestonewildcardid) | Filter issues by milestone ID wildcard. |
| <a id="projectissuesnot"></a>`not` | [`NegatedIssueFilterInput`](#negatedissuefilterinput) | Negated arguments. |
| <a id="projectissuessearch"></a>`search` | [`String`](#string) | Search query for issue title or description. |
| <a id="projectissuessort"></a>`sort` | [`IssueSort`](#issuesort) | Sort issues by this criteria. |
@@ -12172,7 +12584,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="projectsnippetsids"></a>`ids` | [`[SnippetID!]`](#snippetid) | Array of global snippet IDs. For example, `gid://gitlab/ProjectSnippet/1`. |
-| <a id="projectsnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | The visibility of the snippet. |
+| <a id="projectsnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | Visibility of the snippet. |
##### `Project.terraformState`
@@ -12186,6 +12598,28 @@ Returns [`TerraformState`](#terraformstate).
| ---- | ---- | ----------- |
| <a id="projectterraformstatename"></a>`name` | [`String!`](#string) | Name of the Terraform state. |
+##### `Project.timelogs`
+
+Time logged on issues and merge requests in the project.
+
+Returns [`TimelogConnection`](#timelogconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+###### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="projecttimelogsenddate"></a>`endDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or before endDate. |
+| <a id="projecttimelogsendtime"></a>`endTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or before endTime. |
+| <a id="projecttimelogsgroupid"></a>`groupId` | [`GroupID`](#groupid) | List timelogs for a group. |
+| <a id="projecttimelogsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | List timelogs for a project. |
+| <a id="projecttimelogsstartdate"></a>`startDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or after startDate. |
+| <a id="projecttimelogsstarttime"></a>`startTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or after startTime. |
+| <a id="projecttimelogsusername"></a>`username` | [`String`](#string) | List timelogs for a user. |
+
##### `Project.vulnerabilities`
Vulnerabilities reported on the project.
@@ -12212,7 +12646,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
##### `Project.vulnerabilitiesCountByDay`
-Number of vulnerabilities per day for the project.
+The historical number of vulnerabilities per day for the project.
Returns [`VulnerabilitiesCountByDayConnection`](#vulnerabilitiescountbydayconnection).
@@ -12511,7 +12945,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="repositoryblobspaths"></a>`paths` | [`[String!]!`](#string) | Array of desired blob paths. |
-| <a id="repositoryblobsref"></a>`ref` | [`String`](#string) | The commit ref to get the blobs from. Default value is HEAD. |
+| <a id="repositoryblobsref"></a>`ref` | [`String`](#string) | Commit ref to get the blobs from. Default value is HEAD. |
##### `Repository.branchNames`
@@ -12527,6 +12961,24 @@ Returns [`[String!]`](#string).
| <a id="repositorybranchnamesoffset"></a>`offset` | [`Int!`](#int) | The number of branch names to skip. |
| <a id="repositorybranchnamessearchpattern"></a>`searchPattern` | [`String!`](#string) | The pattern to search for branch names by. |
+##### `Repository.paginatedTree`
+
+Paginated tree of the repository. Available only when feature flag `paginated_tree_graphql_query` is enabled. This flag is disabled by default, because the feature is experimental and is subject to change without notice.
+
+Returns [`TreeConnection`](#treeconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+###### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="repositorypaginatedtreepath"></a>`path` | [`String`](#string) | The path to get the tree for. Default value is the root of the repository. |
+| <a id="repositorypaginatedtreerecursive"></a>`recursive` | [`Boolean`](#boolean) | Used to get a recursive tree. Default is false. |
+| <a id="repositorypaginatedtreeref"></a>`ref` | [`String`](#string) | The commit ref to get the tree for. Default value is HEAD. |
+
##### `Repository.tree`
Tree of the repository.
@@ -13322,6 +13774,7 @@ Represents a historically accurate report about the timebox.
| <a id="timelogmergerequest"></a>`mergeRequest` | [`MergeRequest`](#mergerequest) | The merge request that logged time was added to. |
| <a id="timelognote"></a>`note` | [`Note`](#note) | The note where the quick action to add the logged time was executed. |
| <a id="timelogspentat"></a>`spentAt` | [`Time`](#time) | Timestamp of when the time tracked was spent at. |
+| <a id="timelogsummary"></a>`summary` | [`String`](#string) | The summary of how the time was spent. |
| <a id="timelogtimespent"></a>`timeSpent` | [`Int!`](#int) | The time spent displayed in seconds. |
| <a id="timeloguser"></a>`user` | [`UserCore!`](#usercore) | The user that logged the time. |
@@ -13409,6 +13862,7 @@ Core represention of a GitLab user.
| <a id="usercoreid"></a>`id` | [`ID!`](#id) | ID of the user. |
| <a id="usercorelocation"></a>`location` | [`String`](#string) | The location of the user. |
| <a id="usercorename"></a>`name` | [`String!`](#string) | Human-readable name of the user. |
+| <a id="usercorenamespace"></a>`namespace` | [`Namespace`](#namespace) | Personal namespace of the user. |
| <a id="usercoreprojectmemberships"></a>`projectMemberships` | [`ProjectMemberConnection`](#projectmemberconnection) | Project memberships of the user. (see [Connections](#connections)) |
| <a id="usercorepublicemail"></a>`publicEmail` | [`String`](#string) | User's public email. |
| <a id="usercorestate"></a>`state` | [`UserState!`](#userstate) | State of the user. |
@@ -13523,7 +13977,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="usercoresnippetsids"></a>`ids` | [`[SnippetID!]`](#snippetid) | Array of global snippet IDs. For example, `gid://gitlab/ProjectSnippet/1`. |
| <a id="usercoresnippetstype"></a>`type` | [`TypeEnum`](#typeenum) | The type of snippet. |
-| <a id="usercoresnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | The visibility of the snippet. |
+| <a id="usercoresnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | Visibility of the snippet. |
##### `UserCore.starredProjects`
@@ -13541,6 +13995,28 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="usercorestarredprojectssearch"></a>`search` | [`String`](#string) | Search query. |
+##### `UserCore.timelogs`
+
+Time logged by the user.
+
+Returns [`TimelogConnection`](#timelogconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+###### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="usercoretimelogsenddate"></a>`endDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or before endDate. |
+| <a id="usercoretimelogsendtime"></a>`endTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or before endTime. |
+| <a id="usercoretimelogsgroupid"></a>`groupId` | [`GroupID`](#groupid) | List timelogs for a group. |
+| <a id="usercoretimelogsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | List timelogs for a project. |
+| <a id="usercoretimelogsstartdate"></a>`startDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or after startDate. |
+| <a id="usercoretimelogsstarttime"></a>`startTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or after startTime. |
+| <a id="usercoretimelogsusername"></a>`username` | [`String`](#string) | List timelogs for a user. |
+
##### `UserCore.todos`
To-do items of the user.
@@ -13633,6 +14109,7 @@ Represents a vulnerability.
| <a id="vulnerabilitydismissedat"></a>`dismissedAt` | [`Time`](#time) | Timestamp of when the vulnerability state was changed to dismissed. |
| <a id="vulnerabilitydismissedby"></a>`dismissedBy` | [`UserCore`](#usercore) | The user that dismissed the vulnerability. |
| <a id="vulnerabilityexternalissuelinks"></a>`externalIssueLinks` | [`VulnerabilityExternalIssueLinkConnection!`](#vulnerabilityexternalissuelinkconnection) | List of external issue links related to the vulnerability. (see [Connections](#connections)) |
+| <a id="vulnerabilityfalsepositive"></a>`falsePositive` | [`Boolean`](#boolean) | Indicates whether the vulnerability is a false positive. Available only when feature flag `vulnerability_flags` is enabled. This flag is disabled by default, because the feature is experimental and is subject to change without notice. |
| <a id="vulnerabilityhassolutions"></a>`hasSolutions` | [`Boolean`](#boolean) | Indicates whether there is a solution available for this vulnerability. |
| <a id="vulnerabilityid"></a>`id` | [`ID!`](#id) | GraphQL ID of the vulnerability. |
| <a id="vulnerabilityidentifiers"></a>`identifiers` | [`[VulnerabilityIdentifier!]!`](#vulnerabilityidentifier) | Identifiers of the vulnerability. |
@@ -14162,8 +14639,8 @@ Alert status values.
| Value | Description |
| ----- | ----------- |
| <a id="alertmanagementstatusacknowledged"></a>`ACKNOWLEDGED` | Someone is actively investigating the problem. |
-| <a id="alertmanagementstatusignored"></a>`IGNORED` | No action will be taken on the alert. |
-| <a id="alertmanagementstatusresolved"></a>`RESOLVED` | No further work is required. |
+| <a id="alertmanagementstatusignored"></a>`IGNORED` | No action will be taken. |
+| <a id="alertmanagementstatusresolved"></a>`RESOLVED` | The problem has been addressed. |
| <a id="alertmanagementstatustriggered"></a>`TRIGGERED` | Investigation has not started. |
### `ApiFuzzingScanMode`
@@ -14403,6 +14880,7 @@ Status of a container repository.
| Value | Description |
| ----- | ----------- |
| <a id="dastsitevalidationstrategyenumheader"></a>`HEADER` | Header validation. |
+| <a id="dastsitevalidationstrategyenummeta_tag"></a>`META_TAG` | Meta tag validation. |
| <a id="dastsitevalidationstrategyenumtext_file"></a>`TEXT_FILE` | Text file validation. |
### `DastTargetTypeEnum`
@@ -14811,6 +15289,8 @@ Values for sorting merge requests.
| Value | Description |
| ----- | ----------- |
+| <a id="mergerequestsortclosed_at_asc"></a>`CLOSED_AT_ASC` | Closed time by ascending order. |
+| <a id="mergerequestsortclosed_at_desc"></a>`CLOSED_AT_DESC` | Closed time by descending order. |
| <a id="mergerequestsortcreated_asc"></a>`CREATED_ASC` | Created at ascending order. |
| <a id="mergerequestsortcreated_desc"></a>`CREATED_DESC` | Created at descending order. |
| <a id="mergerequestsortlabel_priority_asc"></a>`LABEL_PRIORITY_ASC` | Label priority by ascending order. |
@@ -14888,6 +15368,17 @@ Current state of milestone.
| <a id="milestonestateenumactive"></a>`active` | Milestone is currently active. |
| <a id="milestonestateenumclosed"></a>`closed` | Milestone is closed. |
+### `MilestoneWildcardId`
+
+Milestone ID wildcard values.
+
+| Value | Description |
+| ----- | ----------- |
+| <a id="milestonewildcardidany"></a>`ANY` | A milestone is assigned. |
+| <a id="milestonewildcardidnone"></a>`NONE` | No milestone is assigned. |
+| <a id="milestonewildcardidstarted"></a>`STARTED` | An open, started milestone (start date <= today). |
+| <a id="milestonewildcardidupcoming"></a>`UPCOMING` | An open milestone due in the future (due date >= today). |
+
### `MoveType`
The position to which the adjacent object should be moved.
@@ -14924,6 +15415,15 @@ Negated Iteration ID wildcard values.
| ----- | ----------- |
| <a id="negatediterationwildcardidcurrent"></a>`CURRENT` | Current iteration. |
+### `NegatedMilestoneWildcardId`
+
+Negated Milestone ID wildcard values.
+
+| Value | Description |
+| ----- | ----------- |
+| <a id="negatedmilestonewildcardidstarted"></a>`STARTED` | An open, started milestone (start date <= today). |
+| <a id="negatedmilestonewildcardidupcoming"></a>`UPCOMING` | An open milestone due in the future (due date >= today). |
+
### `NetworkPolicyKind`
Kind of the network policy.
@@ -14943,6 +15443,15 @@ Rotation length unit of an on-call rotation.
| <a id="oncallrotationunitenumhours"></a>`HOURS` | Hours. |
| <a id="oncallrotationunitenumweeks"></a>`WEEKS` | Weeks. |
+### `PackageDependencyType`
+
+| Value | Description |
+| ----- | ----------- |
+| <a id="packagedependencytypebundle_dependencies"></a>`BUNDLE_DEPENDENCIES` | bundleDependencies dependency type. |
+| <a id="packagedependencytypedependencies"></a>`DEPENDENCIES` | dependencies dependency type. |
+| <a id="packagedependencytypedev_dependencies"></a>`DEV_DEPENDENCIES` | devDependencies dependency type. |
+| <a id="packagedependencytypepeer_dependencies"></a>`PEER_DEPENDENCIES` | peerDependencies dependency type. |
+
### `PackageGroupSort`
Values for sorting group packages.
@@ -15183,6 +15692,14 @@ State of a Sentry error.
| <a id="servicetypewebex_teams_service"></a>`WEBEX_TEAMS_SERVICE` | WebexTeamsService type. |
| <a id="servicetypeyoutrack_service"></a>`YOUTRACK_SERVICE` | YoutrackService type. |
+### `SharedRunnersSetting`
+
+| Value | Description |
+| ----- | ----------- |
+| <a id="sharedrunnerssettingdisabled_and_unoverridable"></a>`DISABLED_AND_UNOVERRIDABLE` | Sharing of runners is disabled and unoverridable. |
+| <a id="sharedrunnerssettingdisabled_with_override"></a>`DISABLED_WITH_OVERRIDE` | Sharing of runners is disabled with override. |
+| <a id="sharedrunnerssettingenabled"></a>`ENABLED` | Sharing of runners is enabled. |
+
### `SnippetBlobActionEnum`
Type of a snippet blob input action.
@@ -15290,13 +15807,14 @@ Name of the feature that the callout is for.
| <a id="usercalloutfeaturenameenumpersonal_access_token_expiry"></a>`PERSONAL_ACCESS_TOKEN_EXPIRY` | Callout feature name for personal_access_token_expiry. |
| <a id="usercalloutfeaturenameenumpipeline_needs_banner"></a>`PIPELINE_NEEDS_BANNER` | Callout feature name for pipeline_needs_banner. |
| <a id="usercalloutfeaturenameenumpipeline_needs_hover_tip"></a>`PIPELINE_NEEDS_HOVER_TIP` | Callout feature name for pipeline_needs_hover_tip. |
+| <a id="usercalloutfeaturenameenumprofile_personal_access_token_expiry"></a>`PROFILE_PERSONAL_ACCESS_TOKEN_EXPIRY` | Callout feature name for profile_personal_access_token_expiry. |
| <a id="usercalloutfeaturenameenumregistration_enabled_callout"></a>`REGISTRATION_ENABLED_CALLOUT` | Callout feature name for registration_enabled_callout. |
| <a id="usercalloutfeaturenameenumsecurity_configuration_devops_alert"></a>`SECURITY_CONFIGURATION_DEVOPS_ALERT` | Callout feature name for security_configuration_devops_alert. |
| <a id="usercalloutfeaturenameenumsecurity_configuration_upgrade_banner"></a>`SECURITY_CONFIGURATION_UPGRADE_BANNER` | Callout feature name for security_configuration_upgrade_banner. |
-| <a id="usercalloutfeaturenameenumservice_templates_deprecated_callout"></a>`SERVICE_TEMPLATES_DEPRECATED_CALLOUT` | Callout feature name for service_templates_deprecated_callout. |
| <a id="usercalloutfeaturenameenumsuggest_pipeline"></a>`SUGGEST_PIPELINE` | Callout feature name for suggest_pipeline. |
| <a id="usercalloutfeaturenameenumsuggest_popover_dismissed"></a>`SUGGEST_POPOVER_DISMISSED` | Callout feature name for suggest_popover_dismissed. |
| <a id="usercalloutfeaturenameenumtabs_position_highlight"></a>`TABS_POSITION_HIGHLIGHT` | Callout feature name for tabs_position_highlight. |
+| <a id="usercalloutfeaturenameenumterraform_notification_dismissed"></a>`TERRAFORM_NOTIFICATION_DISMISSED` | Callout feature name for terraform_notification_dismissed. |
| <a id="usercalloutfeaturenameenumthreat_monitoring_info"></a>`THREAT_MONITORING_INFO` | Callout feature name for threat_monitoring_info. |
| <a id="usercalloutfeaturenameenumtrial_status_reminder_d14"></a>`TRIAL_STATUS_REMINDER_D14` | Callout feature name for trial_status_reminder_d14. |
| <a id="usercalloutfeaturenameenumtrial_status_reminder_d3"></a>`TRIAL_STATUS_REMINDER_D3` | Callout feature name for trial_status_reminder_d3. |
@@ -15422,8 +15940,8 @@ Vulnerability sort values.
| <a id="vulnerabilitysortseverity_desc"></a>`severity_desc` | Severity in descending order. |
| <a id="vulnerabilitysortstate_asc"></a>`state_asc` | State in ascending order. |
| <a id="vulnerabilitysortstate_desc"></a>`state_desc` | State in descending order. |
-| <a id="vulnerabilitysorttitle_asc"></a>`title_asc` | Title in ascending order. |
-| <a id="vulnerabilitysorttitle_desc"></a>`title_desc` | Title in descending order. |
+| <a id="vulnerabilitysorttitle_asc"></a>`title_asc` **{warning-solid}** | **Deprecated** in 14.2. Deprecated due to performance issues. |
+| <a id="vulnerabilitysorttitle_desc"></a>`title_desc` **{warning-solid}** | **Deprecated** in 14.2. Deprecated due to performance issues. |
### `VulnerabilityState`
@@ -15809,12 +16327,30 @@ A `PackagesConanMetadatumID` is a global ID. It is encoded as a string.
An example `PackagesConanMetadatumID` is: `"gid://gitlab/Packages::Conan::Metadatum/1"`.
+### `PackagesDependencyID`
+
+A `PackagesDependencyID` is a global ID. It is encoded as a string.
+
+An example `PackagesDependencyID` is: `"gid://gitlab/Packages::Dependency/1"`.
+
+### `PackagesDependencyLinkID`
+
+A `PackagesDependencyLinkID` is a global ID. It is encoded as a string.
+
+An example `PackagesDependencyLinkID` is: `"gid://gitlab/Packages::DependencyLink/1"`.
+
### `PackagesMavenMetadatumID`
A `PackagesMavenMetadatumID` is a global ID. It is encoded as a string.
An example `PackagesMavenMetadatumID` is: `"gid://gitlab/Packages::Maven::Metadatum/1"`.
+### `PackagesNugetDependencyLinkMetadatumID`
+
+A `PackagesNugetDependencyLinkMetadatumID` is a global ID. It is encoded as a string.
+
+An example `PackagesNugetDependencyLinkMetadatumID` is: `"gid://gitlab/Packages::Nuget::DependencyLinkMetadatum/1"`.
+
### `PackagesNugetMetadatumID`
A `PackagesNugetMetadatumID` is a global ID. It is encoded as a string.
@@ -15944,6 +16480,14 @@ abstract types.
### Unions
+#### `DependencyLinkMetadata`
+
+Represents metadata associated with a dependency link.
+
+One of:
+
+- [`NugetDependencyLinkMetadata`](#nugetdependencylinkmetadata)
+
#### `Issuable`
Represents an issuable.
@@ -16234,6 +16778,7 @@ Implementations:
| <a id="userid"></a>`id` | [`ID!`](#id) | ID of the user. |
| <a id="userlocation"></a>`location` | [`String`](#string) | The location of the user. |
| <a id="username"></a>`name` | [`String!`](#string) | Human-readable name of the user. |
+| <a id="usernamespace"></a>`namespace` | [`Namespace`](#namespace) | Personal namespace of the user. |
| <a id="userprojectmemberships"></a>`projectMemberships` | [`ProjectMemberConnection`](#projectmemberconnection) | Project memberships of the user. (see [Connections](#connections)) |
| <a id="userpublicemail"></a>`publicEmail` | [`String`](#string) | User's public email. |
| <a id="userstate"></a>`state` | [`UserState!`](#userstate) | State of the user. |
@@ -16348,7 +16893,7 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="usersnippetsids"></a>`ids` | [`[SnippetID!]`](#snippetid) | Array of global snippet IDs. For example, `gid://gitlab/ProjectSnippet/1`. |
| <a id="usersnippetstype"></a>`type` | [`TypeEnum`](#typeenum) | The type of snippet. |
-| <a id="usersnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | The visibility of the snippet. |
+| <a id="usersnippetsvisibility"></a>`visibility` | [`VisibilityScopesEnum`](#visibilityscopesenum) | Visibility of the snippet. |
###### `User.starredProjects`
@@ -16366,6 +16911,28 @@ four standard [pagination arguments](#connection-pagination-arguments):
| ---- | ---- | ----------- |
| <a id="userstarredprojectssearch"></a>`search` | [`String`](#string) | Search query. |
+###### `User.timelogs`
+
+Time logged by the user.
+
+Returns [`TimelogConnection`](#timelogconnection).
+
+This field returns a [connection](#connections). It accepts the
+four standard [pagination arguments](#connection-pagination-arguments):
+`before: String`, `after: String`, `first: Int`, `last: Int`.
+
+####### Arguments
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="usertimelogsenddate"></a>`endDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or before endDate. |
+| <a id="usertimelogsendtime"></a>`endTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or before endTime. |
+| <a id="usertimelogsgroupid"></a>`groupId` | [`GroupID`](#groupid) | List timelogs for a group. |
+| <a id="usertimelogsprojectid"></a>`projectId` | [`ProjectID`](#projectid) | List timelogs for a project. |
+| <a id="usertimelogsstartdate"></a>`startDate` | [`Time`](#time) | List timelogs within a date range where the logged date is equal to or after startDate. |
+| <a id="usertimelogsstarttime"></a>`startTime` | [`Time`](#time) | List timelogs within a time range where the logged time is equal to or after startTime. |
+| <a id="usertimelogsusername"></a>`username` | [`String`](#string) | List timelogs for a user. |
+
###### `User.todos`
To-do items of the user.
@@ -16429,6 +16996,7 @@ Field that are available while modifying the custom mapping attributes for an HT
| <a id="boardissueinputnot"></a>`not` | [`NegatedBoardIssueInput`](#negatedboardissueinput) | List of negated arguments. |
| <a id="boardissueinputreleasetag"></a>`releaseTag` | [`String`](#string) | Filter by release tag. |
| <a id="boardissueinputsearch"></a>`search` | [`String`](#string) | Search query for issue title or description. |
+| <a id="boardissueinputtypes"></a>`types` | [`[IssueType!]`](#issuetype) | Filter by the given issue types. |
| <a id="boardissueinputweight"></a>`weight` | [`String`](#string) | Filter by weight. |
| <a id="boardissueinputweightwildcardid"></a>`weightWildcardId` | [`WeightWildcardId`](#weightwildcardid) | Filter by weight ID wildcard. Incompatible with weight. |
@@ -16543,8 +17111,9 @@ Represents an escalation rule.
| Name | Type | Description |
| ---- | ---- | ----------- |
| <a id="escalationruleinputelapsedtimeseconds"></a>`elapsedTimeSeconds` | [`Int!`](#int) | The time in seconds before the rule is activated. |
-| <a id="escalationruleinputoncallscheduleiid"></a>`oncallScheduleIid` | [`ID!`](#id) | The on-call schedule to notify. |
+| <a id="escalationruleinputoncallscheduleiid"></a>`oncallScheduleIid` | [`ID`](#id) | The on-call schedule to notify. |
| <a id="escalationruleinputstatus"></a>`status` | [`EscalationRuleStatus!`](#escalationrulestatus) | The status required to prevent the rule from activating. |
+| <a id="escalationruleinputusername"></a>`username` | [`String`](#string) | The username of the user to notify. |
### `JiraUsersMappingInputType`
@@ -16581,6 +17150,7 @@ Represents an escalation rule.
| <a id="negatedboardissueinputmilestonetitle"></a>`milestoneTitle` | [`String`](#string) | Filter by milestone title. |
| <a id="negatedboardissueinputmyreactionemoji"></a>`myReactionEmoji` | [`String`](#string) | Filter by reaction emoji applied by the current user. |
| <a id="negatedboardissueinputreleasetag"></a>`releaseTag` | [`String`](#string) | Filter by release tag. |
+| <a id="negatedboardissueinputtypes"></a>`types` | [`[IssueType!]`](#issuetype) | Filter by the given issue types. |
| <a id="negatedboardissueinputweight"></a>`weight` | [`String`](#string) | Filter by weight. |
### `NegatedEpicBoardIssueInput`
@@ -16617,6 +17187,7 @@ Represents an escalation rule.
| <a id="negatedissuefilterinputiterationwildcardid"></a>`iterationWildcardId` | [`IterationWildcardId`](#iterationwildcardid) | Filter by negated iteration ID wildcard. |
| <a id="negatedissuefilterinputlabelname"></a>`labelName` | [`[String!]`](#string) | Labels not applied to this issue. |
| <a id="negatedissuefilterinputmilestonetitle"></a>`milestoneTitle` | [`[String!]`](#string) | Milestone not applied to this issue. |
+| <a id="negatedissuefilterinputmilestonewildcardid"></a>`milestoneWildcardId` | [`NegatedMilestoneWildcardId`](#negatedmilestonewildcardid) | Filter by negated milestone wildcard values. |
| <a id="negatedissuefilterinputweight"></a>`weight` | [`String`](#string) | Weight not applied to the issue. |
### `OncallRotationActivePeriodInputType`
diff --git a/doc/api/graphql/removed_items.md b/doc/api/graphql/removed_items.md
index d8fc6cb35f8..1c425d5f1d5 100644
--- a/doc/api/graphql/removed_items.md
+++ b/doc/api/graphql/removed_items.md
@@ -41,8 +41,8 @@ Fields removed in [GitLab 14.0](https://gitlab.com/gitlab-org/gitlab/-/merge_req
Fields removed in [GitLab 13.6](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/44866):
| Field name | GraphQL type | Deprecated in | Use instead |
-| -------------------- | -------------------- | ------------- | -------------------------- |
-| `date` | `Timelog` **(STARTER)** | 12.10 | `spentAt` |
+|----------------------|--------------------------|---------------|----------------------------|
+| `date` | `Timelog` | 12.10 | `spentAt` |
| `designs` | `Issue`, `EpicIssue` | 12.2 | `designCollection` |
| `latestPipeline` | `Commit` | 12.5 | `pipelines` |
| `mergeCommitMessage` | `MergeRequest` | 11.8 | `latestMergeCommitMessage` |
diff --git a/doc/api/graphql/users_example.md b/doc/api/graphql/users_example.md
index 1222cd8ee8e..8fbfb67d166 100644
--- a/doc/api/graphql/users_example.md
+++ b/doc/api/graphql/users_example.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/group_milestones.md b/doc/api/group_milestones.md
index a21af94da40..d7de3272005 100644
--- a/doc/api/group_milestones.md
+++ b/doc/api/group_milestones.md
@@ -89,8 +89,8 @@ Parameters:
| `id` | integer/string | yes | The ID or [URL-encoded path of the group](index.md#namespaced-path-encoding) owned by the authenticated user |
| `title` | string | yes | The title of a milestone |
| `description` | string | no | The description of the milestone |
-| `due_date` | date | no | The due date of the milestone, in YYYY-MM-DD format (ISO 8601) |
-| `start_date` | date | no | The start date of the milestone, in YYYY-MM-DD format (ISO 8601) |
+| `due_date` | date | no | The due date of the milestone, in ISO 8601 format (`YYYY-MM-DD`) |
+| `start_date` | date | no | The start date of the milestone, in ISO 8601 format (`YYYY-MM-DD`) |
## Edit milestone
@@ -108,8 +108,8 @@ Parameters:
| `milestone_id` | integer | yes | The ID of a group milestone |
| `title` | string | no | The title of a milestone |
| `description` | string | no | The description of a milestone |
-| `due_date` | date | no | The due date of the milestone, in YYYY-MM-DD format (ISO 8601) |
-| `start_date` | date | no | The start date of the milestone, in YYYY-MM-DD format (ISO 8601) |
+| `due_date` | date | no | The due date of the milestone, in ISO 8601 format (`YYYY-MM-DD`) |
+| `start_date` | date | no | The start date of the milestone, in ISO 8601 format (`YYYY-MM-DD`) |
| `state_event` | string | no | The state event of the milestone _(`close` or `activate`)_ |
## Delete group milestone
diff --git a/doc/api/group_protected_environments.md b/doc/api/group_protected_environments.md
index ce5803fed3c..ddd9ca891d8 100644
--- a/doc/api/group_protected_environments.md
+++ b/doc/api/group_protected_environments.md
@@ -14,7 +14,7 @@ type: concepts, howto
> - To use in GitLab self-managed instances, ask a GitLab administrator to [enable it](../ci/environments/protected_environments.md#enable-or-disable-group-level-protected-environments). **(FREE SELF)**
This in-development feature might not be available for your use. There can be
-[risks when enabling features still in development](../user/feature_flags.md#risks-when-enabling-features-still-in-development).
+[risks when enabling features still in development](../administration/feature_flags.md#risks-when-enabling-features-still-in-development).
Refer to this feature's version history for more details.
Read more about [group-level protected environments](../ci/environments/protected_environments.md#group-level-protected-environments),
diff --git a/doc/api/group_repository_storage_moves.md b/doc/api/group_repository_storage_moves.md
index 53afe8d5ef3..a893bffb1f5 100644
--- a/doc/api/group_repository_storage_moves.md
+++ b/doc/api/group_repository_storage_moves.md
@@ -9,31 +9,35 @@ type: reference
> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/53016) in GitLab 13.9.
-Group repositories can be moved between storages. This can be useful when
-[migrating to Gitaly Cluster](../administration/gitaly/praefect.md#migrate-to-gitaly-cluster), for
-example, or to migrate a Group Wiki.
+Group repositories can be moved between storages. This API can help you when
+[migrating to Gitaly Cluster](../administration/gitaly/index.md#migrate-to-gitaly-cluster), for
+example, or to migrate a [group wiki](../user/project/wiki/index.md#group-wikis).
As group repository storage moves are processed, they transition through different states. Values
of `state` are:
-- `initial`: The record has been created but the background job has not yet been scheduled.
+- `initial`: The record has been created, but the background job has not yet been scheduled.
- `scheduled`: The background job has been scheduled.
- `started`: The group repositories are being copied to the destination storage.
- `replicated`: The group has been moved.
-- `failed`: The group repositories failed to copy or the checksums did not match.
-- `finished`: The group has been moved and the repositories on the source storage have been deleted.
-- `cleanup failed`: The group has been moved but the repositories on the source storage could not be deleted.
+- `failed`: The group repositories failed to copy, or the checksums did not match.
+- `finished`: The group has been moved, and the repositories on the source storage have been deleted.
+- `cleanup failed`: The group has been moved, but the repositories on the source storage could not be deleted.
To ensure data integrity, groups are put in a temporary read-only state for the
-duration of the move. During this time, users receive a `The repository is temporarily
-read-only. Please try again later.` message if they try to push new commits.
+duration of the move. During this time, users receive this message if they try to
+push new commits:
+
+```plaintext
+The repository is temporarily read-only. Please try again later.
+```
This API requires you to [authenticate yourself](index.md#authentication) as an administrator.
-For other type of repositories you can read:
+APIs are also available to move other types of repositories:
-- [Project repository storage moves API](project_repository_storage_moves.md)
-- [Snippet repository storage moves API](snippet_repository_storage_moves.md)
+- [Project repository storage moves API](project_repository_storage_moves.md).
+- [Snippet repository storage moves API](snippet_repository_storage_moves.md).
## Retrieve all group repository storage moves
@@ -41,7 +45,7 @@ For other type of repositories you can read:
GET /group_repository_storage_moves
```
-By default, `GET` requests return 20 results at a time because the API results
+By default, `GET` requests return 20 results at a time, because the API results
are [paginated](index.md#pagination).
Example request:
@@ -71,13 +75,13 @@ Example response:
## Retrieve all repository storage moves for a single group
-In order to retrieve all the repository storage moves for a single group you can use the following endpoint:
+To retrieve all the repository storage moves for a single group you can use the following endpoint:
```plaintext
GET /groups/:group_id/repository_storage_moves
```
-By default, `GET` requests return 20 results at a time because the API results
+By default, `GET` requests return 20 results at a time, because the API results
are [paginated](index.md#pagination).
Supported attributes:
@@ -113,7 +117,8 @@ Example response:
## Get a single group repository storage move
-In order to retrieve a single repository storage move throughout all the existing repository storage moves, you can use the following endpoint:
+To retrieve a single repository storage move throughout all the existing repository
+storage moves, you can use the following endpoint:
```plaintext
GET /group_repository_storage_moves/:repository_storage_id
@@ -150,7 +155,8 @@ Example response:
## Get a single repository storage move for a group
-Given a group, you can retrieve a specific repository storage move for that group, through the following endpoint:
+Given a group, you can retrieve a specific repository storage move for that group,
+through the following endpoint:
```plaintext
GET /groups/:group_id/repository_storage_moves/:repository_storage_id
@@ -197,7 +203,7 @@ Supported attributes:
| Attribute | Type | Required | Description |
| --------- | ---- | -------- | ----------- |
| `group_id` | integer | yes | ID of the group. |
-| `destination_storage_name` | string | no | Name of the destination storage shard. In [GitLab 13.5 and later](https://gitlab.com/gitlab-org/gitaly/-/issues/3209), the storage is selected [automatically based on storage weights](../administration/repository_storage_paths.md#configure-where-new-repositories-are-stored) if not provided. |
+| `destination_storage_name` | string | no | Name of the destination storage shard. In [GitLab 13.5 and later](https://gitlab.com/gitlab-org/gitaly/-/issues/3209), the storage is selected [based on storage weights](../administration/repository_storage_paths.md#configure-where-new-repositories-are-stored) if not provided. |
Example request:
@@ -238,7 +244,7 @@ Supported attributes:
| Attribute | Type | Required | Description |
| --------- | ---- | -------- | ----------- |
| `source_storage_name` | string | yes | Name of the source storage shard. |
-| `destination_storage_name` | string | no | Name of the destination storage shard. The storage is selected [automatically based on storage weights](../administration/repository_storage_paths.md#configure-where-new-repositories-are-stored) if not provided. |
+| `destination_storage_name` | string | no | Name of the destination storage shard. The storage is selected [based on storage weights](../administration/repository_storage_paths.md#configure-where-new-repositories-are-stored) if not provided. |
Example request:
diff --git a/doc/api/groups.md b/doc/api/groups.md
index 23a8dba954f..3831aef10c9 100644
--- a/doc/api/groups.md
+++ b/doc/api/groups.md
@@ -131,7 +131,7 @@ Parameters:
| `id` | integer/string | yes | The ID or [URL-encoded path of the group](index.md#namespaced-path-encoding) of the immediate parent group |
| `skip_groups` | array of integers | no | Skip the group IDs passed |
| `all_available` | boolean | no | Show all the groups you have access to (defaults to `false` for authenticated users, `true` for administrators); Attributes `owned` and `min_access_level` have precedence |
-| `search` | string | no | Return the list of authorized groups matching the search criteria |
+| `search` | string | no | Return the list of authorized groups matching the search criteria. Only subgroup short paths are searched (not full paths) |
| `order_by` | string | no | Order groups by `name`, `path` or `id`. Default is `name` |
| `sort` | string | no | Order groups in `asc` or `desc` order. Default is `asc` |
| `statistics` | boolean | no | Include group statistics (administrators only) |
@@ -189,7 +189,7 @@ Parameters:
| `id` | integer/string | yes | The ID or [URL-encoded path of the group](index.md#namespaced-path-encoding) of the immediate parent group |
| `skip_groups` | array of integers | no | Skip the group IDs passed |
| `all_available` | boolean | no | Show all the groups you have access to (defaults to `false` for authenticated users, `true` for administrators). Attributes `owned` and `min_access_level` have precedence |
-| `search` | string | no | Return the list of authorized groups matching the search criteria |
+| `search` | string | no | Return the list of authorized groups matching the search criteria. Only descendant group short paths are searched (not full paths) |
| `order_by` | string | no | Order groups by `name`, `path`, or `id`. Default is `name` |
| `sort` | string | no | Order groups in `asc` or `desc` order. Default is `asc` |
| `statistics` | boolean | no | Include group statistics (administrators only) |
@@ -288,11 +288,8 @@ Parameters:
| `with_security_reports` | boolean | no | **(ULTIMATE)** Return only projects that have security reports artifacts present in any of their builds. This means "projects with security reports enabled". Default is `false` |
1. Order by similarity: Orders the results by a similarity score calculated from the provided `search`
-URL parameter. This is an [alpha](https://about.gitlab.com/handbook/product/gitlab-the-product/#alpha) feature [introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/221043) in GitLab 13.3.
-
- The feature is behind a feature flag, you can [enable it](../administration/feature_flags.md#enable-or-disable-the-feature)
-with the `similarity_search` flag. When using `order_by=similarity` the `sort` parameter is
-ignored. When the `search` parameter is not provided, the API returns the projects ordered by `name`.
+URL parameter. When using `order_by=similarity`, the `sort` parameter is ignored. When the `search`
+parameter is not provided, the API returns the projects ordered by `name`.
Example response:
diff --git a/doc/api/index.md b/doc/api/index.md
index f1059904ac3..12d01828803 100644
--- a/doc/api/index.md
+++ b/doc/api/index.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
@@ -166,6 +166,15 @@ curl --header "Authorization: Bearer OAUTH-TOKEN" "https://gitlab.example.com/ap
Read more about [GitLab as an OAuth2 provider](oauth2.md).
+NOTE:
+We recommend OAuth access tokens have an expiration. You can use the `refresh_token` parameter
+to refresh tokens. Integrations may need to be updated to use refresh tokens prior to
+expiration, which is based on the [expires_in](https://datatracker.ietf.org/doc/html/rfc6749#appendix-A.14)
+property in the token endpoint response. See [OAuth2 token](oauth2.md) documentation
+for examples requesting a new access token using a refresh token.
+
+A default refresh setting of two hours is tracked in [this issue](https://gitlab.com/gitlab-org/gitlab/-/issues/336598).
+
### Personal/project access tokens
You can use access tokens to authenticate with the API by passing it in either
@@ -254,12 +263,12 @@ tries to steal tokens from other jobs.
> - To use in GitLab self-managed instances, ask a GitLab administrator to [enable it](#enable-or-disable-ci-job-token-scope-limit). **(FREE SELF)**
This in-development feature might not be available for your use. There can be
-[risks when enabling features still in development](../user/feature_flags.md#risks-when-enabling-features-still-in-development).
+[risks when enabling features still in development](../administration/feature_flags.md#risks-when-enabling-features-still-in-development).
Refer to this feature's version history for more details.
You can limit the access scope of a project's CI/CD job token to increase the
job token's security. A job token might give extra permissions that aren't necessary
-to access specific resources. Limiting the job token access scope reduces the risk of a leaked
+to access specific private resources. Limiting the job token access scope reduces the risk of a leaked
token being used to access private data that the user associated to the job can access.
Control the job token access scope with an allowlist of other projects authorized
@@ -273,7 +282,9 @@ setting at all times, and configure the allowlist for cross-project access if ne
For example, when the setting is enabled, jobs in a pipeline in project `A` have
a `CI_JOB_TOKEN` scope limited to project `A`. If the job needs to use the token
-to make an API request to project `B`, then `B` must be added to the allowlist for `A`.
+to make an API request to a private project `B`, then `B` must be added to the allowlist for `A`.
+If project `B` is public or internal, it doesn't need to be added to the allowlist.
+The job token scope is only for controlling access to private projects.
To enable and configure the job token scope limit:
@@ -483,7 +494,7 @@ pass the following parameters:
In the following example, we list 50 [namespaces](namespaces.md) per page:
```shell
-curl --request PUT --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/namespaces?per_page=50"
+curl --request GET --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/namespaces?per_page=50"
```
#### Pagination `Link` header
diff --git a/doc/api/invitations.md b/doc/api/invitations.md
index c79295912fa..26e85a9d9f3 100644
--- a/doc/api/invitations.md
+++ b/doc/api/invitations.md
@@ -42,6 +42,7 @@ POST /projects/:id/invitations
| `access_level` | integer | yes | A valid access level |
| `expires_at` | string | no | A date string in the format YEAR-MONTH-DAY |
| `invite_source` | string | no | The source of the invitation that starts the member creation process. See [this issue](https://gitlab.com/gitlab-org/gitlab/-/issues/327120). |
+| `areas_of_focus` | string | no | Areas the inviter wants the member to focus upon. |
```shell
curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" \
diff --git a/doc/api/issues.md b/doc/api/issues.md
index 6de8912c1af..feec9b31747 100644
--- a/doc/api/issues.md
+++ b/doc/api/issues.md
@@ -1950,6 +1950,7 @@ POST /projects/:id/issues/:issue_iid/add_spent_time
| `duration` | string | yes | The duration in human format. e.g: 3h30m |
| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user |
| `issue_iid` | integer | yes | The internal ID of a project's issue |
+| `summary` | string | no | A summary of how the time was spent |
```shell
curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/5/issues/93/add_spent_time?duration=1h"
diff --git a/doc/api/job_artifacts.md b/doc/api/job_artifacts.md
index 5e2312891ef..0a39400dfd4 100644
--- a/doc/api/job_artifacts.md
+++ b/doc/api/job_artifacts.md
@@ -33,7 +33,7 @@ To use this in a [`script` definition](../ci/yaml/index.md#script) inside
- The `JOB-TOKEN` header with the GitLab-provided `CI_JOB_TOKEN` variable.
For example, the following job downloads the artifacts of the job with ID
- `42`. Note that the command is wrapped into single quotes because it contains a
+ `42`. The command is wrapped in single quotes because it contains a
colon (`:`):
```yaml
@@ -98,7 +98,7 @@ To use this in a [`script` definition](../ci/yaml/index.md#script) inside
- The `JOB-TOKEN` header with the GitLab-provided `CI_JOB_TOKEN` variable.
For example, the following job downloads the artifacts of the `test` job
- of the `main` branch. Note that the command is wrapped into single quotes
+ of the `main` branch. The command is wrapped in single quotes
because it contains a colon (`:`):
```yaml
diff --git a/doc/api/members.md b/doc/api/members.md
index 560fc8262c0..4b383efd792 100644
--- a/doc/api/members.md
+++ b/doc/api/members.md
@@ -27,7 +27,7 @@ for owner.
The `group_saml_identity` attribute is only visible to a group owner for [SSO enabled groups](../user/group/saml_sso/index.md).
-The `email` attribute is only visible to a group owner who manages the user through [Group Managed Accounts](../user/group/saml_sso/group_managed_accounts.md).
+The `email` attribute is only visible for users with public emails.
## List all members of a group or project
@@ -292,7 +292,8 @@ Example response:
"web_url": "http://192.168.1.8:3000/root",
"last_activity_on": "2021-01-27",
"membership_type": "group_member",
- "removable": true
+ "removable": true,
+ "created_at": "2021-01-03T12:16:02.000Z"
},
{
"id": 2,
@@ -304,7 +305,8 @@ Example response:
"email": "john@example.com",
"last_activity_on": "2021-01-25",
"membership_type": "group_member",
- "removable": true
+ "removable": true,
+ "created_at": "2021-01-04T18:46:42.000Z"
},
{
"id": 3,
@@ -315,7 +317,8 @@ Example response:
"web_url": "http://192.168.1.8:3000/root",
"last_activity_on": "2021-01-20",
"membership_type": "group_invite",
- "removable": false
+ "removable": false,
+ "created_at": "2021-01-09T07:12:31.000Z"
}
]
```
@@ -418,6 +421,7 @@ POST /projects/:id/members
| `access_level` | integer | yes | A valid access level |
| `expires_at` | string | no | A date string in the format `YEAR-MONTH-DAY` |
| `invite_source` | string | no | The source of the invitation that starts the member creation process. See [this issue](https://gitlab.com/gitlab-org/gitlab/-/issues/327120). |
+| `areas_of_focus` | string | no | Areas the inviter wants the member to focus upon. |
```shell
curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" \
diff --git a/doc/api/merge_request_approvals.md b/doc/api/merge_request_approvals.md
index 7bcf4d4c875..ef8af608466 100644
--- a/doc/api/merge_request_approvals.md
+++ b/doc/api/merge_request_approvals.md
@@ -954,7 +954,7 @@ POST /projects/:id/merge_requests/:merge_request_iid/approve
| `id` | integer or string | yes | The ID or [URL-encoded path of a project](index.md#namespaced-path-encoding) |
| `merge_request_iid` | integer | yes | The IID of the merge request |
| `sha` | string | no | The `HEAD` of the merge request |
-| `approval_password` **(PREMIUM)** | string | no | Current user's password. Required if [**Require user password to approve**](../user/project/merge_requests/approvals/settings.md#require-authentication-for-approvals) is enabled in the project settings. |
+| `approval_password` **(PREMIUM)** | string | no | Current user's password. Required if [**Require user password to approve**](../user/project/merge_requests/approvals/settings.md#require-user-password-to-approve) is enabled in the project settings. |
The `sha` parameter works in the same way as
when [accepting a merge request](merge_requests.md#accept-mr): if it is passed, then it must
diff --git a/doc/api/merge_requests.md b/doc/api/merge_requests.md
index bc8c0397a3a..b90f0e70a02 100644
--- a/doc/api/merge_requests.md
+++ b/doc/api/merge_requests.md
@@ -2538,6 +2538,7 @@ POST /projects/:id/merge_requests/:merge_request_iid/add_spent_time
| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
| `merge_request_iid` | integer | yes | The internal ID of the merge request. |
| `duration` | string | yes | The duration in human format, such as `3h30m` |
+| `summary` | string | no | A summary of how the time was spent. |
```shell
curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/5/merge_requests/93/add_spent_time?duration=1h"
diff --git a/doc/api/namespaces.md b/doc/api/namespaces.md
index ac8ea95ef30..03aefaf4380 100644
--- a/doc/api/namespaces.md
+++ b/doc/api/namespaces.md
@@ -6,7 +6,8 @@ info: To determine the technical writer assigned to the Stage/Group associated w
# Namespaces API
-Usernames and group names fall under a special category called namespaces.
+Usernames and group names fall under a special category called
+[namespaces](../user/group/index.md#namespaces).
For users and groups supported API calls see the [users](users.md) and
[groups](groups.md) documentation respectively.
@@ -20,8 +21,15 @@ administrator, a list of all namespaces in the GitLab instance is shown.
```plaintext
GET /namespaces
+GET /namespaces?search=foobar
+GET /namespaces?owned_only=true
```
+| Attribute | Type | Required | Description |
+| ------------ | ------- | -------- | ----------- |
+| `search` | string | no | Returns a list of namespaces the user is authorized to view based on the search criteria |
+| `owned_only` | boolean | no | In GitLab 14.2 and later, returns a list of owned namespaces only |
+
Example request:
```shell
@@ -115,48 +123,6 @@ once a day.
NOTE:
Only group owners are presented with `members_count_with_descendants` and `plan`.
-## Search for namespace
-
-Get all namespaces that match a string in their name or path.
-
-```plaintext
-GET /namespaces?search=foobar
-```
-
-| Attribute | Type | Required | Description |
-| --------- | ------ | -------- | ----------- |
-| `search` | string | no | Returns a list of namespaces the user is authorized to see based on the search criteria |
-
-Example request:
-
-```shell
-curl --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/namespaces?search=twitter"
-```
-
-Example response:
-
-```json
-[
- {
- "id": 4,
- "name": "twitter",
- "path": "twitter",
- "kind": "group",
- "full_path": "twitter",
- "parent_id": null,
- "avatar_url": null,
- "web_url": "https://gitlab.example.com/groups/twitter",
- "members_count_with_descendants": 2,
- "billable_members_count": 2,
- "max_seats_used": 0,
- "seats_in_use": 0,
- "plan": "default",
- "trial_ends_on": null,
- "trial": false
- }
-]
-```
-
## Get namespace by ID
Get a namespace by ID.
diff --git a/doc/api/oauth2.md b/doc/api/oauth2.md
index 1b06e554e5e..ce455c89d1a 100644
--- a/doc/api/oauth2.md
+++ b/doc/api/oauth2.md
@@ -83,7 +83,7 @@ Before starting the flow, generate the `STATE`, the `CODE_VERIFIER` and the `COD
which use the characters `A-Z`, `a-z`, `0-9`, `-`, `.`, `_`, and `~`.
- The `CODE_CHALLENGE` is an URL-safe base64-encoded string of the SHA256 hash of the
`CODE_VERIFIER`
- - In Ruby, you can set that up with `Base64.urlsafe_encode64(Digest::SHA256.digest(CODE_VERIFIER))`.
+ - In Ruby, you can set that up with `Base64.urlsafe_encode64(Digest::SHA256.digest(CODE_VERIFIER), padding: false)`.
1. Request authorization code. To do that, you should redirect the user to the
`/oauth/authorize` page with the following query parameters:
@@ -123,6 +123,28 @@ Before starting the flow, generate the `STATE`, the `CODE_VERIFIER` and the `COD
"created_at": 1607635748
}
```
+
+1. To retrieve a new `access_token`, use the `refresh_token` parameter. Refresh tokens may
+ be used even after the `access_token` itself expires. This request:
+ - Invalidates the existing `access_token` and `refresh_token`.
+ - Sends new tokens in the response.
+
+ ```ruby
+ parameters = 'client_id=APP_ID&client_secret=APP_SECRET&refresh_token=REFRESH_TOKEN&grant_type=refresh_token&redirect_uri=REDIRECT_URI&code_verifier=CODE_VERIFIER'
+ RestClient.post 'https://gitlab.example.com/oauth/token', parameters
+ ```
+
+ Example response:
+
+ ```json
+ {
+ "access_token": "c97d1fe52119f38c7f67f0a14db68d60caa35ddc86fd12401718b649dcfa9c68",
+ "token_type": "bearer",
+ "expires_in": 7200,
+ "refresh_token": "803c1fd487fec35562c205dac93e9d8e08f9d3652a24079d704df3039df1158f",
+ "created_at": 1628711391
+ }
+ ```
NOTE:
The `redirect_uri` must match the `redirect_uri` used in the original
@@ -181,6 +203,28 @@ be used as a CSRF token.
"created_at": 1607635748
}
```
+
+1. To retrieve a new `access_token`, use the `refresh_token` parameter. Refresh tokens may
+ be used even after the `access_token` itself expires. This request:
+ - Invalidates the existing `access_token` and `refresh_token`.
+ - Sends new tokens in the response.
+
+ ```ruby
+ parameters = 'client_id=APP_ID&client_secret=APP_SECRET&refresh_token=REFRESH_TOKEN&grant_type=refresh_token&redirect_uri=REDIRECT_URI'
+ RestClient.post 'https://gitlab.example.com/oauth/token', parameters
+ ```
+
+ Example response:
+
+ ```json
+ {
+ "access_token": "c97d1fe52119f38c7f67f0a14db68d60caa35ddc86fd12401718b649dcfa9c68",
+ "token_type": "bearer",
+ "expires_in": 7200,
+ "refresh_token": "803c1fd487fec35562c205dac93e9d8e08f9d3652a24079d704df3039df1158f",
+ "created_at": 1628711391
+ }
+ ```
NOTE:
The `redirect_uri` must match the `redirect_uri` used in the original
diff --git a/doc/api/openapi/openapi_interactive.md b/doc/api/openapi/openapi_interactive.md
index c9434147609..f83ac985131 100644
--- a/doc/api/openapi/openapi_interactive.md
+++ b/doc/api/openapi/openapi_interactive.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/packages/debian.md b/doc/api/packages/debian.md
index cd97bd609df..154c99d7e0a 100644
--- a/doc/api/packages/debian.md
+++ b/doc/api/packages/debian.md
@@ -4,7 +4,11 @@ group: Package
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
-# Debian API
+# Debian API **(FREE SELF)**
+
+> - Debian API [introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/42670) in GitLab 13.5.
+> - Debian group API [introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/66188) in GitLab 14.2.
+> - [Deployed behind a feature flag](../../user/feature_flags.md), disabled by default.
This is the API documentation for [Debian](../../user/packages/debian_repository/index.md).
@@ -24,20 +28,17 @@ for details on which headers and token types are supported.
## Enable the Debian API
-The Debian API for GitLab is behind a feature flag that is disabled by default. GitLab
-administrators with access to the GitLab Rails console can enable this API for your instance.
-
-To enable it:
+The Debian API is behind a feature flag that is disabled by default.
+[GitLab administrators with access to the GitLab Rails console](../../administration/feature_flags.md)
+can opt to enable it. To enable it, follow the instructions in
+[Enable the Debian API](../../user/packages/debian_repository/index.md#enable-the-debian-api).
-```ruby
-Feature.enable(:debian_packages)
-```
+## Enable the Debian group API
-To disable it:
-
-```ruby
-Feature.disable(:debian_packages)
-```
+The Debian group API is behind a feature flag that is disabled by default.
+[GitLab administrators with access to the GitLab Rails console](../../administration/feature_flags.md)
+can opt to enable it. To enable it, follow the instructions in
+[Enable the Debian group API](../../user/packages/debian_repository/index.md#enable-the-debian-group-api).
## Upload a package file
@@ -61,6 +62,38 @@ curl --request PUT \
"https://gitlab.example.com/api/v4/projects/1/packages/debian/mypkg.deb"
```
+## Download a package
+
+> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/64923) in GitLab 14.2.
+
+Download a package file.
+
+```plaintext
+GET projects/:id/packages/debian/pool/:distribution/:letter/:package_name/:package_version/:file_name
+```
+
+| Attribute | Type | Required | Description |
+| ----------------- | ------ | -------- | ----------- |
+| `distribution` | string | yes | The codename or suite of the Debian distribution. |
+| `letter` | string | yes | The Debian Classification (first-letter or lib-first-letter). |
+| `package_name` | string | yes | The source package name. |
+| `package_version` | string | yes | The source package version. |
+| `file_name` | string | yes | The file name. |
+
+```shell
+curl --header "Private-Token: <personal_access_token>" "https://gitlab.example.com/api/v4/projects/1/packages/pool/my-distro/a/my-pkg/1.0.0/example_1.0.0~alpha2_amd64.deb"
+```
+
+Write the output to a file:
+
+```shell
+curl --header "Private-Token: <personal_access_token>" \
+ "https://gitlab.example.com/api/v4/projects/1/packages/pool/my-distro/a/my-pkg/1.0.0/example_1.0.0~alpha2_amd64.deb" \
+ --remote-name
+```
+
+This writes the downloaded file using the remote file name in the current directory.
+
## Route prefix
The remaining endpoints described are two sets of identical routes that each make requests in
@@ -95,7 +128,7 @@ The examples in this document all use the project-level prefix.
> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/64067) in GitLab 14.1.
-Download a Debian package file.
+Download a Debian distribution file.
```plaintext
GET <route-prefix>/dists/*distribution/Release
@@ -117,16 +150,13 @@ curl --header "Private-Token: <personal_access_token>" \
--remote-name
```
-This writes the downloaded file to `Release` in the current directory.
+This writes the downloaded file using the remote file name in the current directory.
## Download a signed distribution Release file
> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/64067) in GitLab 14.1.
-Download a Debian package file.
-
-Signed releases are [not supported](https://gitlab.com/groups/gitlab-org/-/epics/6057#note_582697034).
-Therefore, this endpoint downloads the unsigned release file.
+Download a signed Debian distribution file.
```plaintext
GET <route-prefix>/dists/*distribution/InRelease
@@ -148,4 +178,62 @@ curl --header "Private-Token: <personal_access_token>" \
--remote-name
```
-This writes the downloaded file to `InRelease` in the current directory.
+This writes the downloaded file using the remote file name in the current directory.
+
+## Download a release file signature
+
+> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/64923) in GitLab 14.2.
+
+Download a Debian release file signature.
+
+```plaintext
+GET <route-prefix>/dists/*distribution/Release.gpg
+```
+
+| Attribute | Type | Required | Description |
+| ----------------- | ------ | -------- | ----------- |
+| `distribution` | string | yes | The codename or suite of the Debian distribution. |
+
+```shell
+curl --header "Private-Token: <personal_access_token>" "https://gitlab.example.com/api/v4/projects/1/packages/debian/dists/my-distro/Release.gpg"
+```
+
+Write the output to a file:
+
+```shell
+curl --header "Private-Token: <personal_access_token>" \
+ "https://gitlab.example.com/api/v4/projects/1/packages/debian/dists/my-distro/Release.gpg" \
+ --remote-name
+```
+
+This writes the downloaded file using the remote file name in the current directory.
+
+## Download a binary file's index
+
+> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/64923) in GitLab 14.2.
+
+Download a distribution index.
+
+```plaintext
+GET <route-prefix>/dists/*distribution/:component/binary-:architecture/Packages
+```
+
+| Attribute | Type | Required | Description |
+| ----------------- | ------ | -------- | ----------- |
+| `distribution` | string | yes | The codename or suite of the Debian distribution. |
+| `component` | string | yes | The distribution component name. |
+| `architecture` | string | yes | The distribution architecture type. |
+
+```shell
+curl --header "Private-Token: <personal_access_token>" "https://gitlab.example.com/api/v4/projects/1/packages/debian/dists/my-distro/main/amd64/Packages"
+```
+
+Write the output to a file:
+
+```shell
+curl --header "Private-Token: <personal_access_token>" \
+ "https://gitlab.example.com/api/v4/projects/1/packages/debian/dists/my-distro/main/amd64/Packages" \
+ --remote-name
+```
+
+This writes the downloaded file using the remote file name in the current directory.
diff --git a/doc/api/packages/debian_group_distributions.md b/doc/api/packages/debian_group_distributions.md
index ba61bf49e01..c5d2effcf44 100644
--- a/doc/api/packages/debian_group_distributions.md
+++ b/doc/api/packages/debian_group_distributions.md
@@ -4,30 +4,27 @@ group: Package
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
-# Debian group distributions API **(FREE)**
+# Debian group distributions API **(FREE SELF)**
-> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/5835) in GitLab 14.0.
+> - [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/66188) in GitLab 14.2.
+> - [Deployed behind a feature flag](../../user/feature_flags.md), disabled by default.
-See the [Debian package registry documentation](../../user/packages/debian_repository/index.md)
-for more information about working with Debian packages.
+This is the reference documentation for the Debian group distributions API. This API is behind a
+feature flag that is disabled by default. To use this API, you must [enable it](#enable-the-debian-group-api).
-## Enable Debian repository feature
+WARNING:
+This API is under development and is not meant for production use.
-Debian repository support is gated behind a feature flag that is **disabled by default**.
-[GitLab administrators with access to the GitLab Rails console](../../administration/feature_flags.md)
-can opt to enable it.
-
-To enable it:
-
-```ruby
-Feature.enable(:debian_packages)
-```
+For more information about working with Debian packages, see the
+[Debian package registry documentation](../../user/packages/debian_repository/index.md).
-To disable it:
+## Enable the Debian group API
-```ruby
-Feature.disable(:debian_packages)
-```
+Debian group repository support is still a work in progress. It's gated behind a feature flag that's
+**disabled by default**.
+[GitLab administrators with access to the GitLab Rails console](../../administration/feature_flags.md)
+can opt to enable it. To enable it, follow the instructions in
+[Enable the Debian group API](../../user/packages/debian_repository/index.md#enable-the-debian-group-api).
## List all Debian distributions in a group
diff --git a/doc/api/packages/debian_project_distributions.md b/doc/api/packages/debian_project_distributions.md
index aad5558dcba..bedf3f1f27a 100644
--- a/doc/api/packages/debian_project_distributions.md
+++ b/doc/api/packages/debian_project_distributions.md
@@ -4,30 +4,26 @@ group: Package
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
-# Debian project distributions API **(FREE)**
+# Debian project distributions API **(FREE SELF)**
-> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/5835) in GitLab 14.0.
+> - [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/42670) in GitLab 13.5.
+> - [Deployed behind a feature flag](../../user/feature_flags.md), disabled by default.
-See the [Debian package registry documentation](../../user/packages/debian_repository/index.md)
-for more information about working with Debian packages.
+This is the reference documentation for the Debian project distributions API. This API is behind a
+feature flag that is disabled by default. To use this API, you must [enable the Debian API](#enable-the-debian-api).
-## Enable Debian repository feature
+WARNING:
+This API is under development and is not meant for production use.
-Debian repository support is gated behind a feature flag that is **disabled by default**.
-[GitLab administrators with access to the GitLab Rails console](../../administration/feature_flags.md)
-can opt to enable it.
-
-To enable it:
-
-```ruby
-Feature.enable(:debian_packages)
-```
+For more information about working with Debian packages, see the
+[Debian package registry documentation](../../user/packages/debian_repository/index.md).
-To disable it:
+## Enable the Debian API
-```ruby
-Feature.disable(:debian_packages)
-```
+The Debian API is behind a feature flag that is disabled by default.
+[GitLab administrators with access to the GitLab Rails console](../../administration/feature_flags.md)
+can opt to enable it. To enable it, follow the instructions in
+[Enable the Debian API](../../user/packages/debian_repository/index.md#enable-the-debian-api).
## List all Debian distributions in a project
diff --git a/doc/api/packages/helm.md b/doc/api/packages/helm.md
index a76fa9d3755..f1d5f24cd99 100644
--- a/doc/api/packages/helm.md
+++ b/doc/api/packages/helm.md
@@ -11,8 +11,7 @@ This is the API documentation for [Helm](../../user/packages/helm_repository/ind
WARNING:
This API is used by the Helm-related package clients such as [Helm](https://helm.sh/)
and [`helm-push`](https://github.com/chartmuseum/helm-push/#readme),
-and is generally not meant for manual consumption. This API is under development and is not ready
-for production use due to limited functionality.
+and is generally not meant for manual consumption.
For instructions on how to upload and install Helm packages from the GitLab
Package Registry, see the [Helm registry documentation](../../user/packages/helm_repository/index.md).
diff --git a/doc/api/pipelines.md b/doc/api/pipelines.md
index 7d433923865..ad7336bba8f 100644
--- a/doc/api/pipelines.md
+++ b/doc/api/pipelines.md
@@ -35,7 +35,7 @@ GET /projects/:id/pipelines
| `ref` | string | no | The ref of pipelines |
| `sha` | string | no | The SHA of pipelines |
| `yaml_errors`| boolean | no | Returns pipelines with invalid configurations |
-| `name`| string | no | The name of the user who triggered pipelines |
+| `name`| string | no | _([Deprecated in GitLab 14.2](https://gitlab.com/gitlab-org/gitlab/-/issues/336953))_ The name of the user who triggered pipelines |
| `username`| string | no | The username of the user who triggered pipelines |
| `updated_after` | datetime | no | Return pipelines updated after the specified date. Expected in ISO 8601 format (`2019-03-15T08:00:00Z`). |
| `updated_before` | datetime | no | Return pipelines updated before the specified date. Expected in ISO 8601 format (`2019-03-15T08:00:00Z`). |
@@ -52,6 +52,7 @@ Example of response
[
{
"id": 47,
+ "iid": 12,
"project_id": 1,
"status": "pending",
"ref": "new-pipeline",
@@ -62,6 +63,7 @@ Example of response
},
{
"id": 48,
+ "iid": 13,
"project_id": 1,
"status": "pending",
"ref": "new-pipeline",
@@ -93,6 +95,7 @@ Example of response
```json
{
"id": 46,
+ "iid": 11,
"project_id": 1,
"status": "success",
"ref": "main",
@@ -207,6 +210,59 @@ Sample response:
}
```
+### Get a pipeline's test report summary
+
+> Introduced in [GitLab 14.2](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/65471)
+
+NOTE:
+This API route is part of the [Unit test report](../ci/unit_test_reports.md) feature.
+
+```plaintext
+GET /projects/:id/pipelines/:pipeline_id/test_report_summary
+```
+
+| Attribute | Type | Required | Description |
+|------------|---------|----------|---------------------|
+| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user |
+| `pipeline_id` | integer | yes | The ID of a pipeline |
+
+Sample request:
+
+```shell
+curl --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/1/pipelines/46/test_report_summary"
+```
+
+Sample response:
+
+```json
+{
+ "total": {
+ "time": 1904,
+ "count": 3363,
+ "success": 3351,
+ "failed": 0,
+ "skipped": 12,
+ "error": 0,
+ "suite_error": null
+ },
+ "test_suites": [
+ {
+ "name": "test",
+ "total_time": 1904,
+ "total_count": 3363,
+ "success_count": 3351,
+ "failed_count": 0,
+ "skipped_count": 12,
+ "error_count": 0,
+ "build_ids": [
+ 66004
+ ],
+ "suite_error": null
+ }
+ ]
+}
+```
+
## Create a new pipeline
```plaintext
@@ -228,6 +284,7 @@ Example of response
```json
{
"id": 61,
+ "iid": 21,
"project_id": 1,
"sha": "384c444e840a515b23f21915ee5766b87068a70d",
"ref": "main",
@@ -275,6 +332,7 @@ Response:
```json
{
"id": 46,
+ "iid": 11,
"project_id": 1,
"status": "pending",
"ref": "main",
@@ -322,6 +380,7 @@ Response:
```json
{
"id": 46,
+ "iid": 11,
"project_id": 1,
"status": "canceled",
"ref": "main",
diff --git a/doc/api/project_badges.md b/doc/api/project_badges.md
index 7726261a329..2e4ab0e2b8c 100644
--- a/doc/api/project_badges.md
+++ b/doc/api/project_badges.md
@@ -21,6 +21,7 @@ Badges support placeholders that are replaced in real time in both the link and
- **%{commit_sha}**: Replaced by the last project's commit SHA.
<!-- vale gitlab.Spelling = YES -->
+
## List all badges of a project
Gets a list of a project's badges and its group badges.
diff --git a/doc/api/project_repository_storage_moves.md b/doc/api/project_repository_storage_moves.md
index fe2750fa4bf..ebb15e1c1d6 100644
--- a/doc/api/project_repository_storage_moves.md
+++ b/doc/api/project_repository_storage_moves.md
@@ -10,7 +10,7 @@ type: reference
> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/31285) in GitLab 13.0.
Project repositories including wiki and design repositories can be moved between storages. This can be useful when
-[migrating to Gitaly Cluster](../administration/gitaly/praefect.md#migrate-to-gitaly-cluster),
+[migrating to Gitaly Cluster](../administration/gitaly/index.md#migrate-to-gitaly-cluster),
for example.
As project repository storage moves are processed, they transition through different states. Values
diff --git a/doc/api/projects.md b/doc/api/projects.md
index 72de8ab6844..a510f05df58 100644
--- a/doc/api/projects.md
+++ b/doc/api/projects.md
@@ -19,6 +19,8 @@ Values for the project visibility level are:
- `internal`: the project can be cloned by any signed-in user except [external users](../user/permissions.md#external-users).
- `public`: the project can be accessed without any authentication.
+For more, read [Project visibility](../public_access/public_access.md).
+
## Project merge method
There are three options for `merge_method` to choose from:
@@ -47,11 +49,11 @@ GET /projects
| `archived` | boolean | **{dotted-circle}** No | Limit by archived status. |
| `id_after` | integer | **{dotted-circle}** No | Limit results to projects with IDs greater than the specified ID. |
| `id_before` | integer | **{dotted-circle}** No | Limit results to projects with IDs less than the specified ID. |
-| `last_activity_after` | datetime | **{dotted-circle}** No | Limit results to projects with last_activity after specified time. Format: ISO 8601 `YYYY-MM-DDTHH:MM:SSZ` |
-| `last_activity_before` | datetime | **{dotted-circle}** No | Limit results to projects with last_activity before specified time. Format: ISO 8601 `YYYY-MM-DDTHH:MM:SSZ` |
+| `last_activity_after` | datetime | **{dotted-circle}** No | Limit results to projects with last_activity after specified time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ`) |
+| `last_activity_before` | datetime | **{dotted-circle}** No | Limit results to projects with last_activity before specified time. Format: ISO 8601 (`YYYY-MM-DDTHH:MM:SSZ`) |
| `membership` | boolean | **{dotted-circle}** No | Limit by projects that the current user is a member of. |
| `min_access_level` | integer | **{dotted-circle}** No | Limit by current user minimal [access level](members.md#valid-access-levels). |
-| `order_by` | string | **{dotted-circle}** No | Return projects ordered by `id`, `name`, `path`, `created_at`, `updated_at`, or `last_activity_at` fields. `repository_size`, `storage_size`, `packages_size` or `wiki_size` fields are only allowed for admins. Default is `created_at`. |
+| `order_by` | string | **{dotted-circle}** No | Return projects ordered by `id`, `name`, `path`, `created_at`, `updated_at`, `last_activity_at`, or `similarity` fields. `repository_size`, `storage_size`, `packages_size` or `wiki_size` fields are only allowed for admins. `similarity` ([introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/332890) in GitLab 14.1) is only available when searching and is limited to projects that the current user is a member of. Default is `created_at`. |
| `owned` | boolean | **{dotted-circle}** No | Limit by projects explicitly owned by the current user. |
| `repository_checksum_failed` **(PREMIUM)** | boolean | **{dotted-circle}** No | Limit projects where the repository checksum calculation has failed ([Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/6137) in [GitLab Premium](https://about.gitlab.com/pricing/) 11.2). |
| `repository_storage` | string | **{dotted-circle}** No | Limit results to projects stored on `repository_storage`. _(admins only)_ |
@@ -147,7 +149,8 @@ When the user is authenticated and `simple` is not set this returns something li
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -236,7 +239,8 @@ When the user is authenticated and `simple` is not set this returns something li
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -423,7 +427,8 @@ GET /users/:user_id/projects
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -512,7 +517,8 @@ GET /users/:user_id/projects
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -661,7 +667,8 @@ Example response:
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -743,7 +750,8 @@ Example response:
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -869,7 +877,8 @@ GET /projects/:id
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"container_expiration_policy": {
"cadence": "7d",
"enabled": false,
@@ -1179,7 +1188,8 @@ POST /projects
| `builds_access_level` | string | **{dotted-circle}** No | One of `disabled`, `private`, or `enabled`. |
| `ci_config_path` | string | **{dotted-circle}** No | The path to CI configuration file. |
| `container_expiration_policy_attributes` | hash | **{dotted-circle}** No | Update the image cleanup policy for this project. Accepts: `cadence` (string), `keep_n` (integer), `older_than` (string), `name_regex` (string), `name_regex_delete` (string), `name_regex_keep` (string), `enabled` (boolean). Valid values for `cadence` are: `1d` (every day), `7d` (every week), `14d` (every two weeks), `1month` (every month), or `3month` (every quarter). |
-| `container_registry_enabled` | boolean | **{dotted-circle}** No | Enable container registry for this project. |
+| `container_registry_enabled` | boolean | **{dotted-circle}** No | _(Deprecated)_ Enable container registry for this project. Use `container_registry_access_level` instead. |
+| `container_registry_access_level` | string | **{dotted-circle}** No | Set visibility of container registry, for this project, to one of `disabled`, `private` or `enabled`. |
| `default_branch` | string | **{dotted-circle}** No | The [default branch](../user/project/repository/branches/default.md) name. Requires `initialize_with_readme` to be `true`. |
| `description` | string | **{dotted-circle}** No | Short project description. |
| `emails_disabled` | boolean | **{dotted-circle}** No | Disable email notifications. |
@@ -1254,7 +1264,8 @@ POST /projects/user/:user_id
| `build_timeout` | integer | **{dotted-circle}** No | The maximum amount of time, in seconds, that a job can run. |
| `builds_access_level` | string | **{dotted-circle}** No | One of `disabled`, `private`, or `enabled`. |
| `ci_config_path` | string | **{dotted-circle}** No | The path to CI configuration file. |
-| `container_registry_enabled` | boolean | **{dotted-circle}** No | Enable container registry for this project. |
+| `container_registry_enabled` | boolean | **{dotted-circle}** No | _(Deprecated)_ Enable container registry for this project. Use `container_registry_access_level` instead. |
+| `container_registry_access_level` | string | **{dotted-circle}** No | Set visibility of container registry, for this project, to one of `disabled`, `private` or `enabled`. |
| `description` | string | **{dotted-circle}** No | Short project description. |
| `default_branch` | string | **{dotted-circle}** No | The [default branch](../user/project/repository/branches/default.md) name. Requires `initialize_with_readme` to be `true`. |
| `emails_disabled` | boolean | **{dotted-circle}** No | Disable email notifications. |
@@ -1331,7 +1342,8 @@ PUT /projects/:id
| `ci_default_git_depth` | integer | **{dotted-circle}** No | Default number of revisions for [shallow cloning](../ci/pipelines/settings.md#limit-the-number-of-changes-fetched-during-clone). |
| `ci_forward_deployment_enabled` | boolean | **{dotted-circle}** No | When a new deployment job starts, [skip older deployment jobs](../ci/pipelines/settings.md#skip-outdated-deployment-jobs) that are still pending |
| `container_expiration_policy_attributes` | hash | **{dotted-circle}** No | Update the image cleanup policy for this project. Accepts: `cadence` (string), `keep_n` (integer), `older_than` (string), `name_regex` (string), `name_regex_delete` (string), `name_regex_keep` (string), `enabled` (boolean). |
-| `container_registry_enabled` | boolean | **{dotted-circle}** No | Enable container registry for this project. |
+| `container_registry_enabled` | boolean | **{dotted-circle}** No | _(Deprecated)_ Enable container registry for this project. Use `container_registry_access_level` instead. |
+| `container_registry_access_level` | string | **{dotted-circle}** No | Set visibility of container registry, for this project, to one of `disabled`, `private` or `enabled`. |
| `default_branch` | string | **{dotted-circle}** No | The [default branch](../user/project/repository/branches/default.md) name. |
| `description` | string | **{dotted-circle}** No | Short project description. |
| `emails_disabled` | boolean | **{dotted-circle}** No | Disable email notifications. |
@@ -1471,7 +1483,8 @@ Example responses:
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -1563,7 +1576,8 @@ Example response:
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -1661,7 +1675,8 @@ Example response:
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -1839,7 +1854,8 @@ Example response:
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -1958,7 +1974,8 @@ Example response:
"snippets_enabled": false,
"can_create_merge_request_in": true,
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": false,
+ "container_registry_enabled": false, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "disabled",
"created_at": "2013-09-30T13:46:02Z",
"last_activity_at": "2013-09-30T13:46:02Z",
"creator_id": 3,
@@ -2203,6 +2220,29 @@ DELETE /projects/:id/share/:group_id
curl --request DELETE --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/5/share/17"
```
+## Import project members
+
+Import members from another project.
+
+```plaintext
+POST /projects/:id/import_project_members/:project_id
+```
+
+| Attribute | Type | Required | Description |
+|--------------|-------------------|------------------------|-------------|
+| `id` | integer or string | **{check-circle}** Yes | The ID or [URL-encoded path](index.md#namespaced-path-encoding) of the target project to receive the members. |
+| `project_id` | integer or string | **{check-circle}** Yes | The ID or [URL-encoded path](index.md#namespaced-path-encoding) of the source project to import the members from. |
+
+```shell
+curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.example.com/api/v4/projects/5/import_project_members/32"
+```
+
+Returns:
+
+- `200 OK` on success.
+- `404 Project Not Found` if the target or source project does not exist or cannot be accessed by the requester.
+- `422 Unprocessable Entity` if the import of project members does not complete successfully.
+
## Hooks
Also called Project Hooks and Webhooks. These are different for [System Hooks](system_hooks.md)
@@ -2561,7 +2601,8 @@ Example response:
"archived": false,
"visibility": "private",
"resolve_outdated_diff_discussions": false,
- "container_registry_enabled": true,
+ "container_registry_enabled": true, // deprecated, use container_registry_access_level instead
+ "container_registry_access_level": "enabled",
"container_expiration_policy": {
"cadence": "7d",
"enabled": false,
diff --git a/doc/api/releases/index.md b/doc/api/releases/index.md
index cb688b81336..35bf24c586c 100644
--- a/doc/api/releases/index.md
+++ b/doc/api/releases/index.md
@@ -15,6 +15,15 @@ info: To determine the technical writer assigned to the Stage/Group associated w
> - [The permission model for create, update and delete actions was fixed](https://gitlab.com/gitlab-org/gitlab/-/issues/327505) in GitLab 14.1.
See [Release permissions](../../user/project/releases/index.md#release-permissions) for more information.
+## Authentication
+
+For authentication, the Releases API accepts either:
+
+- A [Personal Access Token](../../user/profile/personal_access_tokens.md) using the
+ `PRIVATE-TOKEN` header.
+- The [GitLab CI/CD job token](../index.md#gitlab-cicd-job-token) `$CI_JOB_TOKEN` using
+ the `JOB-TOKEN` header.
+
## List Releases
Paginated list of Releases, sorted by `released_at`.
diff --git a/doc/api/repositories.md b/doc/api/repositories.md
index 7e50a2c9f4c..9d464c94d99 100644
--- a/doc/api/repositories.md
+++ b/doc/api/repositories.md
@@ -22,11 +22,11 @@ Supported attributes:
| Attribute | Type | Required | Description |
| :---------- | :------------- | :------- | :---------- |
-| `id` | integer/string | no | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
-| `path` | string | yes | The path inside repository. Used to get content of subdirectories. |
-| `ref` | string | yes | The name of a repository branch or tag or if not given the default branch. |
-| `recursive` | boolean | yes | Boolean value used to get a recursive tree (false by default). |
-| `per_page` | integer | yes | Number of results to show per page. If not specified, defaults to `20`. [Learn more on pagination](index.md#pagination). |
+| `id` | integer/string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
+| `path` | string | no | The path inside repository. Used to get content of subdirectories. |
+| `ref` | string | no | The name of a repository branch or tag or if not given the default branch. |
+| `recursive` | boolean | no | Boolean value used to get a recursive tree (false by default). |
+| `per_page` | integer | no | Number of results to show per page. If not specified, defaults to `20`. [Learn more on pagination](index.md#pagination). |
```json
[
@@ -85,7 +85,7 @@ Supported attributes:
## Get a blob from repository
Allows you to receive information about blob in repository like size and
-content. Note that blob content is Base64 encoded. This endpoint can be accessed
+content. Blob content is Base64 encoded. This endpoint can be accessed
without authentication if the repository is publicly accessible.
```plaintext
@@ -112,8 +112,8 @@ Supported attributes:
| Attribute | Type | Required | Description |
| :-------- | :------- | :------- | :---------- |
-| `id` | datatype | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
-| `sha` | datatype | yes | The blob SHA. |
+| `id` | integer or string | yes | The ID or [URL-encoded path of the project](index.md#namespaced-path-encoding) owned by the authenticated user. |
+| `sha` | string | yes | The blob SHA. |
## Get file archive
@@ -149,7 +149,7 @@ curl --header "PRIVATE-TOKEN: <your_access_token>" "https://gitlab.com/api/v4/pr
## Compare branches, tags or commits
This endpoint can be accessed without authentication if the repository is
-publicly accessible. Note that diffs could have an empty diff string if [diff limits](../development/diffs.md#diff-limits) are reached.
+publicly accessible. Diffs can have an empty diff string if [diff limits](../development/diffs.md#diff-limits) are reached.
```plaintext
GET /projects/:id/repository/compare
@@ -607,7 +607,7 @@ template: |
{% end %}
```
-Note that when specifying the template you should use `template: |` and not
+When specifying the template you should use `template: |` and not
`template: >`, as the latter doesn't preserve newlines in the template.
### Template data
diff --git a/doc/api/repository_files.md b/doc/api/repository_files.md
index 0dc50543f1e..1e33aadbc1b 100644
--- a/doc/api/repository_files.md
+++ b/doc/api/repository_files.md
@@ -24,7 +24,7 @@ in the following table.
## Get file from repository
Allows you to receive information about file in repository like name, size,
-content. Note that file content is Base64 encoded. This endpoint can be accessed
+content. File content is Base64 encoded. This endpoint can be accessed
without authentication if the repository is publicly accessible.
```plaintext
diff --git a/doc/api/services.md b/doc/api/services.md
index 3652dd99fcd..8daaa532ff4 100644
--- a/doc/api/services.md
+++ b/doc/api/services.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
@@ -259,7 +259,7 @@ GET /projects/:id/services/buildkite
## Campfire
Send notifications about push events to Campfire chat rooms.
-Note that [new users can no longer sign up for Campfire](https://basecamp.com/retired/campfire).
+[New users can no longer sign up for Campfire](https://basecamp.com/retired/campfire).
### Create/Edit Campfire service
@@ -695,16 +695,15 @@ Get Hangouts Chat service settings for a project.
GET /projects/:id/services/hangouts-chat
```
-## Irker (IRC gateway)
+## irker (IRC gateway)
-Send IRC messages, on update, to a list of recipients through an Irker gateway.
+Send IRC messages, on update, to a list of recipients through an irker gateway.
-### Create/Edit Irker (IRC gateway) service
+For more information, see the [irker integration documentation](../user/project/integrations/irker.md).
-Set Irker (IRC gateway) service for a project.
+### Create/Edit irker (IRC gateway) service
-NOTE:
-Irker does NOT have built-in authentication, which makes it vulnerable to spamming IRC channels if it is hosted outside of a firewall. Please make sure you run the daemon within a secured network to prevent abuse. For more details, read [Security analysis of `irker`](http://www.catb.org/~esr/irker/security.html).
+Set irker (IRC gateway) service for a project.
```plaintext
PUT /projects/:id/services/irker
@@ -721,17 +720,17 @@ Parameters:
| `colorize_messages` | boolean | false | Colorize messages |
| `push_events` | boolean | false | Enable notifications for push events |
-### Delete Irker (IRC gateway) service
+### Delete irker (IRC gateway) service
-Delete Irker (IRC gateway) service for a project.
+Delete irker (IRC gateway) service for a project.
```plaintext
DELETE /projects/:id/services/irker
```
-### Get Irker (IRC gateway) service settings
+### Get irker (IRC gateway) service settings
-Get Irker (IRC gateway) service settings for a project.
+Get irker (IRC gateway) service settings for a project.
```plaintext
GET /projects/:id/services/irker
diff --git a/doc/api/settings.md b/doc/api/settings.md
index d49dca96dfd..d49359b5d43 100644
--- a/doc/api/settings.md
+++ b/doc/api/settings.md
@@ -79,6 +79,7 @@ Example response:
"asset_proxy_whitelist": ["example.com", "*.example.com", "your-instance.com"],
"asset_proxy_allowlist": ["example.com", "*.example.com", "your-instance.com"],
"npm_package_requests_forwarding": true,
+ "pypi_package_requests_forwarding": true,
"snippet_size_limit": 52428800,
"issues_create_limit": 300,
"raw_blob_request_limit": 300,
@@ -96,7 +97,7 @@ Example response:
```
Users on GitLab [Premium or Ultimate](https://about.gitlab.com/pricing/) may also see
-the `file_template_project_id`, `deletion_adjourned_period`, or the `geo_node_allowed_ips` parameters:
+the `file_template_project_id`, `delayed_project_deletion`, `deletion_adjourned_period`, or the `geo_node_allowed_ips` parameters:
```json
{
@@ -104,6 +105,7 @@ the `file_template_project_id`, `deletion_adjourned_period`, or the `geo_node_al
"signup_enabled" : true,
"file_template_project_id": 1,
"geo_node_allowed_ips": "0.0.0.0/0, ::/0",
+ "delayed_project_deletion": false,
"deletion_adjourned_period": 7,
...
}
@@ -179,6 +181,7 @@ Example response:
"allow_local_requests_from_web_hooks_and_services": true,
"allow_local_requests_from_system_hooks": false,
"npm_package_requests_forwarding": true,
+ "pypi_package_requests_forwarding": true,
"snippet_size_limit": 52428800,
"issues_create_limit": 300,
"raw_blob_request_limit": 300,
@@ -200,6 +203,7 @@ these parameters:
- `file_template_project_id`
- `geo_node_allowed_ips`
- `geo_status_timeout`
+- `delayed_project_delection`
- `deletion_adjourned_period`
Example responses: **(PREMIUM SELF)**
@@ -241,8 +245,9 @@ listed in the descriptions of the relevant settings.
| `check_namespace_plan` | boolean | no | **(PREMIUM)** Enabling this makes only licensed EE features available to projects if the project namespace's plan includes the feature or if the project is public. |
| `commit_email_hostname` | string | no | Custom hostname (for private commit emails). |
| `container_registry_token_expire_delay` | integer | no | Container Registry token duration in minutes. |
-| `deactivate_dormant_users` | boolean | no | Enable [atomatic deactivation of dormant users](../user/admin_area/moderate_users.md#automatically-deactivate-dormant-users). |
+| `deactivate_dormant_users` | boolean | no | Enable [automatic deactivation of dormant users](../user/admin_area/moderate_users.md#automatically-deactivate-dormant-users). |
| `default_artifacts_expire_in` | string | no | Set the default expiration time for each job's artifacts. |
+| `default_branch_name` | string | no | [Instance-level custom initial branch name](../user/project/repository/branches/default.md#instance-level-custom-initial-branch-name) ([introduced](https://gitlab.com/gitlab-org/gitlab/-/issues/225258) in GitLab 13.2). |
| `default_branch_protection` | integer | no | Determine if developers can push to the default branch. Can take: `0` _(not protected, both developers and maintainers can push new commits, force push, or delete the branch)_, `1` _(partially protected, developers and maintainers can push new commits, but cannot force push, or delete, the branch)_ or `2` _(fully protected, developers cannot push new commits, but maintainers can; no-one can force push or delete the branch)_ as a parameter. Default is `2`. |
| `default_ci_config_path` | string | no | Default CI/CD configuration file and path for new projects (`.gitlab-ci.yml` if not set). |
| `default_group_visibility` | string | no | What visibility level new groups receive. Can take `private`, `internal` and `public` as a parameter. Default is `private`. |
@@ -250,6 +255,7 @@ listed in the descriptions of the relevant settings.
| `default_project_visibility` | string | no | What visibility level new projects receive. Can take `private`, `internal` and `public` as a parameter. Default is `private`. |
| `default_projects_limit` | integer | no | Project limit per user. Default is `100000`. |
| `default_snippet_visibility` | string | no | What visibility level new snippets receive. Can take `private`, `internal` and `public` as a parameter. Default is `private`. |
+| `delayed_project_deletion` | boolean | no | **(PREMIUM SELF)** Enable delayed project deletion by default in new groups. Default is `false`. |
| `deletion_adjourned_period` | integer | no | **(PREMIUM SELF)** The number of days to wait before deleting a project or group that is marked for deletion. Value must be between 0 and 90.
| `diff_max_patch_bytes` | integer | no | Maximum [diff patch size](../user/admin_area/diff_limits.md), in bytes. |
| `diff_max_files` | integer | no | Maximum [files in a diff](../user/admin_area/diff_limits.md). |
@@ -324,7 +330,7 @@ listed in the descriptions of the relevant settings.
| `html_emails_enabled` | boolean | no | Enable HTML emails. |
| `import_sources` | array of strings | no | Sources to allow project import from, possible values: `github`, `bitbucket`, `bitbucket_server`, `gitlab`, `fogbugz`, `git`, `gitlab_project`, `gitea`, `manifest`, and `phabricator`. |
| `in_product_marketing_emails_enabled` | boolean | no | Enable [in-product marketing emails](../user/profile/notifications.md#global-notification-settings). Enabled by default. |
-| `invisible_captcha_enabled` | boolean | no | <!-- vale gitlab.Spelling = NO --> Enable Invisible Captcha <!-- vale gitlab.Spelling = YES --> spam detection during sign-up. Disabled by default. |
+| `invisible_captcha_enabled` | boolean | no | Enable Invisible CAPTCHA spam detection during sign-up. Disabled by default. |
| `issues_create_limit` | integer | no | Max number of issue creation requests per minute per user. Disabled by default.|
| `keep_latest_artifact` | boolean | no | Prevent the deletion of the artifacts from the most recent successful jobs, regardless of the expiry time. Enabled by default. |
| `local_markdown_version` | integer | no | Increase this value when any cached Markdown should be invalidated. |
@@ -343,6 +349,7 @@ listed in the descriptions of the relevant settings.
| `mirror_max_capacity` | integer | no | **(PREMIUM)** Maximum number of mirrors that can be synchronizing at the same time. |
| `mirror_max_delay` | integer | no | **(PREMIUM)** Maximum time (in minutes) between updates that a mirror can have when scheduled to synchronize. |
| `npm_package_requests_forwarding` | boolean | no | **(PREMIUM)** Use npmjs.org as a default remote repository when the package is not found in the GitLab Package Registry for npm. |
+| `pypi_package_requests_forwarding` | boolean | no | **(PREMIUM)** Use pypi.org as a default remote repository when the package is not found in the GitLab Package Registry for PyPI. |
| `outbound_local_requests_whitelist` | array of strings | no | Define a list of trusted domains or IP addresses to which local requests are allowed when local requests for hooks and services are disabled.
| `pages_domain_verification_enabled` | boolean | no | Require users to prove ownership of custom domains. Domain verification is an essential security measure for public GitLab sites. Users are required to demonstrate they control a domain before it is enabled. |
| `password_authentication_enabled_for_git` | boolean | no | Enable authentication for Git over HTTP(S) via a GitLab account password. Default is `true`. |
@@ -370,7 +377,7 @@ listed in the descriptions of the relevant settings.
| `repository_size_limit` | integer | no | **(PREMIUM)** Size limit per repository (MB) |
| `repository_storages_weighted` | hash of strings to integers | no | (GitLab 13.1 and later) Hash of names of taken from `gitlab.yml` to [weights](../administration/repository_storage_paths.md#configure-where-new-repositories-are-stored). New projects are created in one of these stores, chosen by a weighted random selection. |
| `repository_storages` | array of strings | no | (GitLab 13.0 and earlier) List of names of enabled storage paths, taken from `gitlab.yml`. New projects are created in one of these stores, chosen at random. |
-| `require_admin_approval_after_user_signup` | boolean | no | When enabled, any user that signs up for an account using the registration form is placed under a **Pending approval** state and has to be explicitly [approved](../user/admin_area/approving_users.md) by an administrator. |
+| `require_admin_approval_after_user_signup` | boolean | no | When enabled, any user that signs up for an account using the registration form is placed under a **Pending approval** state and has to be explicitly [approved](../user/admin_area/moderate_users.md) by an administrator. |
| `require_two_factor_authentication` | boolean | no | (**If enabled, requires:** `two_factor_grace_period`) Require all users to set up Two-factor authentication. |
| `restricted_visibility_levels` | array of strings | no | Selected levels cannot be used by non-Administrator users for groups, projects or snippets. Can take `private`, `internal` and `public` as a parameter. Default is `null` which means there is no restriction. |
| `rsa_key_restriction` | integer | no | The minimum allowed bit length of an uploaded RSA key. Default is `0` (no restriction). `-1` disables RSA keys. |
diff --git a/doc/api/snippet_repository_storage_moves.md b/doc/api/snippet_repository_storage_moves.md
index 9951e073c39..a73542c8505 100644
--- a/doc/api/snippet_repository_storage_moves.md
+++ b/doc/api/snippet_repository_storage_moves.md
@@ -10,7 +10,7 @@ type: reference
> [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/49228) in GitLab 13.8.
Snippet repositories can be moved between storages. This can be useful when
-[migrating to Gitaly Cluster](../administration/gitaly/praefect.md#migrate-to-gitaly-cluster), for
+[migrating to Gitaly Cluster](../administration/gitaly/index.md#migrate-to-gitaly-cluster), for
example.
As snippet repository storage moves are processed, they transition through different states. Values
diff --git a/doc/api/system_hooks.md b/doc/api/system_hooks.md
index 1f0bce1c78f..39a3ccb2bc3 100644
--- a/doc/api/system_hooks.md
+++ b/doc/api/system_hooks.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/usage_data.md b/doc/api/usage_data.md
index 7a7f36ce43a..00d87c89faf 100644
--- a/doc/api/usage_data.md
+++ b/doc/api/usage_data.md
@@ -13,7 +13,7 @@ The Service Data API is associated with [Service Ping](../development/service_pi
> - [Introduced](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/57270) in GitLab 13.11.
-Export all metric definitions as a single YAML file, similar to the [Metrics Dictionary](../development/usage_ping/dictionary.md), for easier importing.
+Export all metric definitions as a single YAML file, similar to the [Metrics Dictionary](https://gitlab-org.gitlab.io/growth/product-intelligence/metric-dictionary), for easier importing.
```plaintext
GET /usage_data/metric_definitions
diff --git a/doc/api/users.md b/doc/api/users.md
index 0d922487cf9..6ba751bd292 100644
--- a/doc/api/users.md
+++ b/doc/api/users.md
@@ -109,6 +109,7 @@ GET /users
| `two_factor` | string | no | Filter users by Two-factor authentication. Filter values are `enabled` or `disabled`. By default it returns all users |
| `without_projects` | boolean | no | Filter users without projects. Default is `false`, which means that all users are returned, with and without projects. |
| `admins` | boolean | no | Return only admin users. Default is `false` |
+| `saml_provider_id` **(PREMIUM)** | number | no | Return only users created by the specified SAML provider ID. If not included, it returns all users. |
```json
[
@@ -407,7 +408,7 @@ users. Either `password`, `reset_password`, or `force_random_password`
must be specified. If `reset_password` and `force_random_password` are
both `false`, then `password` is required.
-Note that `force_random_password` and `reset_password` take priority
+`force_random_password` and `reset_password` take priority
over `password`. In addition, `reset_password` and
`force_random_password` can be used together.
@@ -433,7 +434,7 @@ Parameters:
| `email` | Yes | Email |
| `extern_uid` | No | External UID |
| `external` | No | Flags the user as external - true or false (default) |
-| `extra_shared_runners_minutes_limit` | No | Extra pipeline minutes quota for this user (purchased in addition to the minutes included in the plan) **(STARTER)** |
+| `extra_shared_runners_minutes_limit` | No | Extra pipeline minutes quota for this user (purchased in addition to the minutes included in the plan) **(PREMIUM)** |
| `force_random_password` | No | Set user password to a random value - true or false (default) |
| `group_id_for_saml` | No | ID of group where SAML has been configured |
| `linkedin` | No | LinkedIn |
@@ -446,7 +447,7 @@ Parameters:
| `projects_limit` | No | Number of projects user can create |
| `provider` | No | External provider name |
| `reset_password` | No | Send user password reset link - true or false(default) |
-| `shared_runners_minutes_limit` | No | Pipeline minutes quota for this user (included in plan). Can be `nil` (default; inherit system default), `0` (unlimited) or `> 0` **(STARTER)** |
+| `shared_runners_minutes_limit` | No | Pipeline minutes quota for this user (included in plan). Can be `nil` (default; inherit system default), `0` (unlimited) or `> 0` **(PREMIUM)** |
| `skip_confirmation` | No | Skip confirmation - true or false (default) |
| `skype` | No | Skype ID |
| `theme_id` | No | The GitLab theme for the user (see [the user preference docs](../user/profile/preferences.md#navigation-theme) for more information) |
@@ -475,7 +476,7 @@ Parameters:
| `email` | No | Email |
| `extern_uid` | No | External UID |
| `external` | No | Flags the user as external - true or false (default) |
-| `extra_shared_runners_minutes_limit` | No | Extra pipeline minutes quota for this user (purchased in addition to the minutes included in the plan) **(STARTER)** |
+| `extra_shared_runners_minutes_limit` | No | Extra pipeline minutes quota for this user (purchased in addition to the minutes included in the plan) **(PREMIUM)** |
| `group_id_for_saml` | No | ID of group where SAML has been configured |
| `id` | Yes | The ID of the user |
| `linkedin` | No | LinkedIn |
@@ -488,7 +489,7 @@ Parameters:
| `projects_limit` | No | Limit projects each user can create |
| `provider` | No | External provider name |
| `public_email` | No | The public email of the user (must be already verified) |
-| `shared_runners_minutes_limit` | No | Pipeline minutes quota for this user (included in plan). Can be `nil` (default; inherit system default), `0` (unlimited) or `> 0` **(STARTER)** |
+| `shared_runners_minutes_limit` | No | Pipeline minutes quota for this user (included in plan). Can be `nil` (default; inherit system default), `0` (unlimited) or `> 0` **(PREMIUM)** |
| `skip_reconfirmation` | No | Skip reconfirmation - true or false (default) |
| `skype` | No | Skype ID |
| `theme_id` | No | The GitLab theme for the user (see [the user preference docs](../user/profile/preferences.md#navigation-theme) for more information) |
@@ -858,9 +859,13 @@ Example response:
Get the counts (same as in top right menu) of the currently signed in user.
-| Attribute | Type | Description |
-| ---------------- | ------ | ------------------------------------------------------------ |
-| `merge_requests` | number | Merge requests that are active and assigned to current user. |
+| Attribute | Type | Description |
+| --------------------------------- | ------ | ---------------------------------------------------------------------------- |
+| `assigned_issues` | number | Number of issues that are open and assigned to the current user. [Added](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/66909) in GitLab 14.2. |
+| `assigned_merge_requests` | number | Number of merge requests that are active and assigned to the current user. [Added](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/50026) in GitLab 13.8. |
+| `merge_requests` | number | [Deprecated](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/50026) in GitLab 13.8. Equivalent to and replaced by `assigned_merge_requests`. |
+| `review_requested_merge_requests` | number | Number of merge requests that the current user has been requested to review. [Added](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/50026) in GitLab 13.8. |
+| `todos` | number | Number of pending to-do items for current user. [Added](https://gitlab.com/gitlab-org/gitlab/-/merge_requests/66909) in GitLab 14.2. |
```plaintext
GET /user_counts
@@ -874,7 +879,11 @@ Example response:
```json
{
- "merge_requests": 4
+ "merge_requests": 4,
+ "assigned_issues": 15,
+ "assigned_merge_requests": 11,
+ "review_requested_merge_requests": 0,
+ "todos": 1
}
```
@@ -1537,7 +1546,7 @@ curl --request POST --header "PRIVATE-TOKEN: <your_access_token>" "https://gitla
Returns:
-- `201 OK` on success.
+- `201 Created` on success.
- `404 User Not Found` if user cannot be found.
- `403 Forbidden` if the user cannot be approved because they are blocked by an administrator or by LDAP synchronization.
@@ -1599,7 +1608,7 @@ Example response:
> Requires admin permissions.
> Token values are returned once. Make sure you save it - you can't access it again.
-It creates a new impersonation token. Note that only administrators can do this.
+It creates a new impersonation token. Only administrators can do this.
You are only able to create impersonation tokens to impersonate the user and perform
both API calls and Git reads and writes. The user can't see these tokens in their profile
settings page.
@@ -1757,7 +1766,7 @@ Example response:
]
```
-Please note that `last_activity_at` is deprecated, please use `last_activity_on`.
+`last_activity_at` is deprecated. Use `last_activity_on` instead.
## User memberships (admin only)
diff --git a/doc/api/v3_to_v4.md b/doc/api/v3_to_v4.md
index 69e1ea56c2c..8875e4daa87 100644
--- a/doc/api/v3_to_v4.md
+++ b/doc/api/v3_to_v4.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---
diff --git a/doc/api/version.md b/doc/api/version.md
index 313ba4da7d4..b23930e70f9 100644
--- a/doc/api/version.md
+++ b/doc/api/version.md
@@ -1,6 +1,6 @@
---
-stage: Create
-group: Ecosystem
+stage: Ecosystem
+group: Integrations
info: To determine the technical writer assigned to the Stage/Group associated with this page, see https://about.gitlab.com/handbook/engineering/ux/technical-writing/#assignments
---